Minsan May Isang Kamote

time capsule

2012-01-10T00:21:00.008+08:00

higit tatlong taon na pala ang nakalipas nang simulan kong subukan, na ipinta ang aking nararamdaman gamit ang tinta ng pag-iisip dito sa isang sulok at pader ng kaunlaran. at kung babalikan ang mga pangyayari, hindi patas na ikumpara ang sarili sa pagkatao ko noon at sa ngayon. at sa tingin ko, hindi na rin kailangan pang banggitin na pareho sila na may kalakasan at kahinaan. kung ang paligoy-ligoy ay wawakasan, isa lang naman ang nais kong isulat sa kapirasong papel ng kasalukuyan.. ngunit ito'y halos ka-babanggit ko lamang.. uulitin ko na lang, gaya ng ginagawa ng tinatawag nating oras..

nagsisimula na naman ang isang taon, binibilang natin itong ika-dalawang libo at ika-labing dalawang taon matapos ang kapanganakan ng, pasintabi sa ibang paniniwala, Tagapagligtas. at halos kasisimula pa lang rin ng aking ika-dalawampu't walong paglalagi sa mundong ibabaw, ay nakakatawang isipin na kung ang pagbabasihan ay ang karaniwan na pagbibilang at pag-iisip ng tao, na sinisimulan sa unang saglit ng taon, ay magmimistulang madadagdagan agad ito ng isa. ano nga naman at gaano karami ang maaring mangyari sa loob ng labing isang buwan?

sa usaping damdamin, ito ay masasabing puno ng saya at galak, kasama ang mga mahal sa buhay at kaibigan. sa pansariling laban, ginagawa ko ang lahat ng upang lalo pang mapabuti ang sarili, ayon sa nararapat. ngunit bilang isang tao rin lamang, ginagawa ko ang lahat upang ma-itago, ma-ibsan, o ma-pukaw ang pangamba, na likha ng tas-tas ng ala-alang nakaraan, at hibla ng pala-isipang hinaharap. sa kabila ng lahat, tamis man o pait, nagpapasalamat ako sa kahapon, at umaasa na patuloy na magiging malugod ang bukas.

heto't ini-isang tabi na, ang iba pang mga bagay ay halos di' bigyan pansin. at sa iyo, ikaw na naririto, yayakapin at buong loob kitang tatangapin..

maligayang bagong taon, ngayon! ^^

- * - = - * -

expiration date

2011-10-15T23:08:00.002+08:00

parang isang bagyo. parating na sya. kahit anong mind over matter. mararamdaman at mararamdaman mo. magmamarka na naman ba ako ng isang ekis sa buhay ko? ayoko na. nakakasawa na. nakakainis na. oo putcha nakakalungkot. nakakaiyak. nakakahiya na kung sa nakakahiya.

bilib din naman talaga ako sa "tayming" mo. sumabay ka pa! hindi na talaga nakakatuwa. hindi ko na talaga alam kung tanga ako o tanga lang talaga ako.

redundant na kung sasabihin kong walang sense..

ako_si_elmo

2011-09-18T22:38:00.006+08:00

isang mabilis lang..

mukhangmasyadongmaramingnangyayaringayonsabuhaykomasyadongmabilisdirediretsomalupetura-uradabakaisa-isahinkorinangmgadetalyesasusunod..

walaakongideyasapwedengkahinatnanangmgaitosiguronamannararamdamanmonasapagtyatiyagamopalangsapagbasanetokungsabagayhindinamantalagaakoyungtiponamagalingmagplanongpangmatagalanyung "long-term" baperominsannamannagagawakominsanchambaokayanamanminsanchambaparinahbastabastabamasayaanglahatgamelang!

atiyonsiguroanggustokonggawingpuntongayonanggumawang "beacon" parasasarilikokungmakalimutankomankungsinoakookungnakalimutankonabagokopagawintobastamulasapuntongitonagiisaatwalangibaakoitoisangmalupet..

ako!! ako si elmo!

minsanmayisangkamote.. ^^

this just in!

2011-08-19T18:17:00.003+08:00

Nitong mga nakaraang linggo nagkaroon ako ng pagkakataon para makapaglaboy, mapagisa, makapagisip, kumain ng balat ng manok ni manong sa kanto, at kung anu-ano pa.. At kanina, since wala kaming pasok sa bangko, nagkaroon ako ng mas mahabang tambay sa banyo, na isa sa mga paborito kong lugar para makapagisip btw, at nakaisip ako ng nakakadiring ideya: ang gamitin ang tumblr account ko!

Minsan naisip ko na gustong-gusto ng buong kalawakan ang pakikipagkwentuhan sa atin.. At sa tingin ko, magaling sya magkwento na kasing galing niya makinig.. Ang tanong, “adik ka ba!!??”.

Sino ba naman ang taong nasa tamang pagiisip na sasabihin na; ginigising tayo ng buong kalawakan sa umaga gamit ang huni ng mga ibon, sa tunog ng ulan, o sa init ng araw na tatama sa mukha naten galing sa bintana, o minsan, sa huni ng mga kapitbahay na nagchichismisan; na sinasabi sa aten ng kalawakan kung saan ka magandang kumain sa tanghali gamit ang pinapadala niyang mga leaflet, o sa pinapadala niyang mga kaibigan mu para yayain ka mananghalian, o sa hindi mo malamang dahilan na biglang gusto mo kumain ng palaka; na hanggang gabi inaalalayan ka nya pauwi gamit ang mga walang kwentang road sign ng mmda na nakatago sa makapal na puno na nagsasabing “no u-turn” at paparahin ka ng kaibigan mong pulis at hihingin ang lisensya mo pero mas gusto mo na lang na bigyan siya ng pangmiryenda (trip lang!); na inaawitan ka ng kalawakan hanggang sa pagtulog mo gamit ang kantang “ignorance” ng paramore, o kung suswertehin ka, sa huni pa rin ng mga kapitbahay mong malulupet kumanta sa bidyoke habang dumidighay, o hindi mo lang talaga alam na dumidighay lang pala talaga siya sa simula pa lang..

Ngayon, gusto kong bigyang daan ang mga kwento ng kalawakan.. Susubukan ko ilagay sa tumblr account ko ang mga sa tingin ko ay kinukwento niya gamit ang (but not limited to) mga sinasabi ng mga tao sa paligid ko, sa mga naririnig kong chismax, sa mga kanta, sa mga palabas, sa radyo, at kung anu-ano pang s#!t.. Hmmm.. At tatawagin ko itong “Random Thought Booster”!! Bwa Ha Ha Ha Ha!! (thunder strikes somewhere).. Ang baduy shet! T@e kelangan ko ng gwapong pangalan.. Ah basta..

Bilang panimula, nung isang araw, naghahanap ako ng fx papuntang market-market habang nasa tapat ng isang iskwelahan sa pasig.. Si “koia barker”, ay tamang badtrip, o tamang madaldal lang talaga sila sa mga kung anu-ano, ay may binanggit sa mga estudyante na naghihintay ng sasakyan..

“Mahirap kayong intindihin, pero madali kayong unawain..”

Lupet ni “Koia” noh? ^^

http://minsanmayisangkamote.tumblr.com/post/9118255630/this-just-in-1-mahirap-kayo-intindihin-pero

oy!

2011-04-24T00:26:00.003+08:00

one elmorre: oy! musta na?! nabuhay ka?!

two elmorre: linggo kasi ng pagkabuhay..

one elmorre: weh!? korny mu ha.. hindi ka kaya mahilig maki-uso, or makisabay sa mga tao! lokohin mo lelang mu! takot ka sa tao eh! nyaha! peace!

two elmorre: ehehehehe.. nagkataon lang men.. kakagaling ko lang kasi sa labas, nagpahangin, nag-isip (kung meron isip).. tsaka wala rin makausap ng matino eh.. yoko rin naman magdota, grraduweyt na 'ko don men! ayuz ba?!

one elmorre: tadew! ay teka, ano sa tingin mu saken, matino kausap? naks! nambobola pa si gagew.. so ano na nangyari sau? anu mga pinagkakaabalahan mu netong nakaraan?

two elmorre: wala lang.. nakakabanas nga eh, kasi.. hmm... kasi... aaaa... ayun! hhhmmm.. well actually wala lang talaga..

one elmorre: try mu kasi gumawa ng iba..

two elmorre: huh? watcha mean?!

one elmorre: alam mu na, kaya kasi wala nangyayari na bago sayo eh kasi, yon! same statement, baligtarin mo lang ng konte..

two elmorre: labo mo kaya!

one elmorre: o sige clue.. ganito yan eh.. ahh.. hhmm... teka! sabi ko nga kasi same statement eh! pero baligtarin mo lang ng konte! yun na rin kasi ung clue eh! ambobo neto.. nag-grade one ka ba?!

two elmorre: eh ang gulo mo kaya! ano nga kasi yown?!

one elmorre: kaw ang magulo! kasi un na nga kasi, kung ano ung tanong, eh un na rin kasi ung clue, and at the same time un na rin ang sagot! sinabi ko na kasi.. tapos kasi parang ang gusto mong mangyari eh "ulitin ko" ung "pag-ulit" ko ng statement, which is, kapag "inulit" ko ung "pag-ulit" ng statement na yon, eh magiging "paulit-ulit" na lang ang "pag-uulit" ko, where-in mawawalan ng sense ung "pag-ulit" kasi nga hindi mo binaligtad ng konte.. o sige, tignan mu, try mu mag-isip.. 10x mo "ulitin" ang pag-iisip.. malalaman mo na ang simple-simple lang naman kasi nang dapat mong gawin, "ulitin" mo lang ung unang statement na yon pero baligtarin mo lang ng konte, para hindi na "maulit" ung kung ano mang "pa-uli-ulit" na mali na ginagawa mo kung meron man.. isipin mo na lang na parang last na "ulit" na lang ang gagawin mong "pag-ulit", para hindi mo na kelangan "magpa-ulit-ulit".. engot neto..

two elmorre: ah ganun ba? ok ngaun getz ko na kung ano un.. nung una kasi paikot-ikot ka pa eh! apir!

one elmorre: apir!

^^

Torpedo.

2010-09-19T00:28:00.012+08:00

Tinatayang tatlong oras bago ngayon..

Hindi ko alam kung ano na ang nangyayari, nagulat na lang ako ng sabihin ko sa kanya, "So pano, tuloy na ako..", pero mas nagulat yata ako sa sinabi niya na, "Wag muna, pasok ka muna sa loob". Pumayag ako. Sa mga pagkakataon na yon, paroot' parito pa rin ang ulirat ko sa realidad at sa kung saan mang dimension. Pero isang beses sa realidad, inabot niya sa akin ang isang “scrap-book” na naglalaman ng "luma" at "bagong" larawan niya. Classic! Sa kabilang banda, facebook, literal! Parang siya lang ang kakilala ko na gumagawa nun ah! Iba ung dating eh. Habang tinitignan ko iyon, napangiti ang utak ko, at madami akong nalaman tungkol sa kanya, bukod sa kinukwento na niya ang bawat isa, kundi dahil sa mga kinuwento ng mismong mga larawan na iyon. Oo nga pala, extra ako sa nakaraan niya, pero hindi sa kahit isa man lang sa mga larawan. Asa ka pa.

Tinatayang apat oras bago ngayon..

Nasa bus kame. Naisip kong masyado na akong nalilibang. Dahil doon, nagsimula akong mangamote, kasabay ang paghahanap ng magandang pagkakataon para ibato ang "punchline". Tameme. Para akong naglalakad sa kalbaryo na gawa ng utak ko. Sa gitna ng usapan, naisip kong natatakot na siya gawa ng nakaraan niya. Nagtanong ako, “So pano maalis ang ‘trauma’?”. Naintindihan niya ang ibig kong sabihin, sumagot siya, “Siguro kapag dumating na ung ‘the one’.”. Biglang lumindol ang mundo ko. Nagpa-panic na ako. Sa mga pagkakataon na yon hindi ko sigurado kung ang mga sumunod na usapan ay nangyari sa totoong mundo o sa isang dimension lang sa utak ko. Tanong uli ako, “Eh pano mo malalaman kung nandyan na ung ‘the one’?”. Sagot uli niya, “Malalaman mo naman un, alam mo ung, kapag nagkakasundo kayo sa mga bagay-bagay.”. Tameme uli. O hindi lang talaga ako nabuhay para sa mga ganitong eksena.

Tinatayang lima-at-kalahating oras bago ngayon..

Kasalukuyang nage-enjoy sa panonood namen ng mga islomong eksena ng mga lumilipad na bala, bato, bakal, dugo, at kung anu-ano pa, sa gitna ng labanan ng isang babae at mga zombies, 3D. Yeahhh! Nerd.

Tinatayang pitong oras bago ngayon..

Sana hindi na matapos to. Masaya akong nakatingin sa mga mata niya habang nagku-kwento siya. Kinigilig yata ako.

Tinatayang walong oras bago ngayon..

Kwentuhan. Biruan. Naglalakad kame nang walang direksyon. Lumalapang ng sundae. Window shopping. At eto pa ang malupet, nagugustuhan ko ang mga “anggulo” na nakikita ng mga mata ko (if you know what i mean. *wink*).

Tinatayang sampung oras bago ngayon..

“Tuloy na po kame ate, kuya”, sabi ko sa iba pang mga tao sa bahay nila. Ilang hakbang pa, nagkahiyaan pa kame kung sino ang mauuna sa gate. Pinauna niya ako. Naisip niya sigurong gusto na talaga ako lapain ng aso niyang si “leia”. Tumuloy kame sa pinaghintay kong taxi. Neutral ang kamote.

Tinatayang labing-isang oras bago ngayon..

Dito na rin naman ako napadaan, habang nakatingin sa isang bakeshop, naalala ko ang nabanggit niya noon na gusto niya “nun”. Bumili ako ng isa para sa kanya. Ngiti.

Tinatayang labing-dalawang oras bago ngayon..

Naghahanda para sa isang lakad. Oo gusto ko siya pero wala lang to’. Sa kabilang banda, dalawa lang kame; isang babae, isang lalake. Sino ang niloko ko?! Syempre may malisya to’!

Balik sa ngayon..

Hindi mapakali. Isa lang ang nabanggit..

“Sana”..

Blog on the go...

2010-08-28T20:42:00.002+08:00

Yeah I know it’s been a while since I’ve been here. And there’s really a lot of things that have and has been going on and going through my head that I wanted to write here, and there are a lot of times, well actually every time, it feels like my head will explode for not writing every thoughts I have or events happening in my life from one moment to another. So for now, here’s my quick fix.

And oh, by the way, I wrote this one last Wednesday, and it’s just now that I got the chance to post it here. My notebook is full of these un-posted things already. Anyway, here goes another crap out of my head...

Last Sunday after my band practice, I went to see my friends/classmates from 3^rd year high school, those who are still staying here in Manila, in a karaoke night they’ve arranged using facebook. 21^st century. Wow! I got to chat and had a lot of laughs with them, and it’s so nice exchanging news on what’s going on with them. There’s even secrets from way back that’s just recently revealed. Oh well. There’s this one classmate that I got to talk to about a lot of things including, err, love life. She even told me that she’s having problems with her current boyfriend. Oh wait, that’s still not the problem, she’s in love with him, as in crazy, martyr in-love, even with the fact that this particular loser boyfriend had cheated on her a couple of times already. Hmmm… Omit the crazy part, because hey, there’s crazy in all of us. Ok moving on. I just supported her in her decision, and told her to keep holding on…

What?! Something wrong with what I said? What can I do?! It is this “so-called” “L. O. V. E.” thing that we are talking about! It seems real to me so, I can’t argue with that you know. Good times.

Earlier, while preparing for work, something reminded me of what we talked about that night. I realized, when people usually give advice about love and relationships, they say something like, “do not give your 100% self or your 100% love” kind of, crap? I’d say what the hell. I did not mention any of that by the way. Aside from just supporting her, I should have told her, or should I say, added on my advice to her, which I also want to say to everyone, as my two cents to this particular phenomenon of being human, to just, “Not loose or forget who she is / who we are”.

What I have just said was unclear to me as well. But there’s a question my self gave me from that line...

“Do you know yourself in the first place”?

Etsa Pwera Pera

2010-07-02T00:06:00.003+08:00

Sweldo mo na ba? Alam na!

Ok ganito, sa loob ng tatlong segundo pagkatapos ko pakawalan ang tanong, kelangan mo sabihin saken ang pinakaunang sagot na papasok sa isip mo. Game? Game.

"Nanalo ka sa lotto ng 200 million pesos. Ano ang gagawin mo sa pera?"

Three. Two. One.

Eeeeeennngggkkk!! Time's up!

Siguro madami-dami na rin sa mga kakilala ko ang pinag-tanungan ko nyan, pero halos lahat ay magkakapareho ng sagot. Siguro naman may ideya ka kung anu-ano yung mga tipikal na sagot na isinagot nila. Pero bakit kaya ganun? Nawi-weirdohan ako sa sarili ko kasi wala akong pakelam sa pera eh. Pero hindi ko sinasabi na hindi ko kelangan ng pera ha! Hindi ko lang talaga alam kung bakit nahihirapan ako makipag-usap ng tungkol sa pera, kaya siguro napag-isipan ko na wag nang pag-isipan ang tungkol sa pera. Labo. Sige usapang pera tayo, since karamihan ng mga nagta-trabaho eh kaka-sweldo lang. Speaking of trabaho, nang mawala ako sa industriya ng "Call Center", naisipan kong magtrabaho para sa mga kilalang bangko. Iyon e para sanayin ang sarili ko sa usaping pera. Malamang kasi sa araw-araw na gagawin ni Lord e puro usaping pera ang kakaharapin ko. Walang kawala. Tunog walang palyang plano. Kaya siguro nagtagumpay naman ako at eto, nasa "Telecommunications" industry na ako. Eto na. May trabaho na uli ako. Pero hindi ko maintindihan kung baket ngayon pa ako pinuputakte ng isyu tungkol sa pera kesa noong isa akong dalubhasang tambay!? Pormang walang pera naman ako. Ung tipong tumambay lang siguro ako sa isang gilid ng daan kaharap ang isang lata ng "Alaska", eh malamang yagitz na yatigz ang datingan ko. Pero hindi eh, ang tingin saken ng ibang tao ay para bang kaya kong bilihin ang buong mundo! Mukha ba akong ATM machine?

Sa pilosopiya lang siguro nagkakatalo. Example. Meron akong tropa na may trabaho naman, at sinabi niya saken na meron siyang natitipuang "bebe" na gusto niyang ligawan. Ang kaso, tamang anak ng "Coquangco" o "Lopez" o "Ayala" o kung sino mang kilalang hirodes na mayaman dito sa Pilipinas ang datingan ng bruha. Medyo nakaka-ilang nga naman. Pero sinabi ko pa rin na "Ano naman?!" Malamang kasi kumakain pa rin naman ng kanin un! Tumatae sa umaga. Umuutot ng patago paminsan-minsan. In-short, tao pa rin! Kaya pwede! Eh kaso bigla niyang sinabi saken na wala siyang pera. Anak ng tinapa! Parang nakalimutan ko panandalian ang pinag-uusapan namen. Pero nang bumalik ang ulirat ko, sa isip-isip ko, parang plano nya yata bilihin ung babae. E mahirap talaga un! Goodluck!

Oo. Napaka-ipokrito sabihin na sa panahon ngayon ay hindi mo iko-konsidera ang pera sa kung ano mang gagawin mo. Lalo na dito sa Pilipinas. Lalo na dito sa Maynila. Nakakalungkot nga lang isipin na palaging top one ang tinatawag nilang "pera" sa mga usapin. Try mo pansinin. Matatawa ka na lang siguro sa pagkabigo na sa kahit isang araw, kahit isang araw lang, eh walang magbabanggit ng salitang "pera" sa paligid mo. Pustahan pa tayo oh! May bente pa ako dito sa bulsa. GG ka pramis!

Para sa akin kasi eh simple lang ang buhay. Kelangan mo ng pera, oo, wala akong argumento dun. Pero wag mo kakalimutan na gamit lang din ang pera. Wag mong hahayaan na gamitin ka nito. Hindi mo kelangan magbuhay mayaman. Gaano ba naman ung agahan mo araw-araw Frenchbaker, tanghalian mo Itallianis, hapunan mo T.G.I.Fridays?! Ok na siguro un! Pero mas ok siguro kung babawasan ko kayabangan ko. Pero seryoso, ikaw pa rin naman ang mamimili sa huli. Ano mas gusto mo? Ang problemahin "ang" pera? O, problemahin "ng" pera?

Hhhhhhmmmm... Ano kaya?..

Tama na to'ng topic na to! Nakakaurat talaga! Kain na lang tayo! Cancel na yung pustahan kasi libre na lang kita ng burger, bente pesos, presyong pang-adik, "Buy-one-take-one" jan sa kanto! Tara! ^^

Waiting for the rain

2010-06-11T21:48:00.003+08:00

“I don’t know”. That’s the phrase I’ve been using a lot lately. I’m not sure if I should be glad if I don’t know or I’m not certain about a thing or two, or should I be cautious. Well what the heck. I overslept again this morning where-in I don’t see any reason why my body should. But I feel so down. No particular reason. I feel like sh*t in the middle of the road being scattered to pieces by a heavy pouring rain. I feel so out of place. I feel so way down. I can’t seem to smile a lot and I’m not sure why. I also noticed myself spacing out a lot lately. And earlier, even a once-in-a-lifetime-sit-beside-a-solofly-super-cute-college-girl-in-her-uniform-in-an-almost-empty-aircon-bus-while-stuck-in-traffic-along-edsa-ayala happened, and yet, I did not do something about it. I just stared up to the gloomy sky, wishing for the rain.

There is so much to do. Also, it’s Friday and I should be off somewhere. There’s even an event that will be held tomorrow where my number one crush in the whole Philippines will be attending, and my friends invited me to take some photos and asked me if I can come. Guess what I answered? “I don’t know”. Well it’s because I just don’t know my schedule yet. I’m still waiting for important calls (yes, even on Saturdays). Or maybe it’s because I feel like this is a crappy week and I’ve been on a losing streak. It is really putting me so out of mood. I think my mom even noticed it earlier and asked me what is wrong. I just told her, “wala lang”. Even my cat, named Bubbles, as I’m writing this, jumps on the table, and five centimeters right into my face, gave me an unusual blank stare. I responded by lying the right side of my face flat on the notebook.

I hope tomorrow will be better.

Come on, self! Get over it already and cheer up!

The rainy season is around anyway!

Cheer up. Cheer up! ^^

Silver to a Vampire

2010-05-27T20:38:00.004+08:00

I believe there are really vampires on this world. But I think not as exaggerated as the movies would portray it. And I on the other hand, consider myself as a vampire, in the sense that I’m one of those who are awake during night time, and loves to sleep and just laze around during day time, especially, like on a cloudy sky we had today. Scientific explanation lies on ones body or biological clock. Anyway, let’s just say vampires are really vulnerable to silver. And what if someone who is close to them, someone who is unaware of their true story, gave them silver as a gift? If you are that vampire, would you accept it? Or just throw it away and suck the life out of that pathetic human you value the most?

Well! It’s just hypothetical. But with the same level of scenario, it’s one of the reasons I don’t like gifts. Not that I hate it. I just don’t like awkward situations wherein you are caught in between. Two funny things are; I’m also thankful for gifts, well it’s free right?! And it’s mostly given in goodwill and also can be used as an expression of appreciation. And the other one is, when you realize, it’s those awkward situations that also makes life worthwhile.

One of those random thought that occupies my empty mind on the way home.

Bahala na si Batman

2010-05-07T20:48:00.007+08:00

Madami na nga ang tunog na pumapasok sa isip ko, iba-iba pa ang tiyempo at pabago-bago pa ang kinakalabasan. Pero hindi pa naman tapos to'. Baka madami pa akong baguhin. Sa ngayon, eto muna ang pagtiyagaan mo sa pinaka-masayang kanta na gawa ng paborito kong pagkakamali. Islaman na! ^^

♫♪ Bahala na si Batman ♪♫

minsanmayisangkamote

Stanza 1

Ok tara, dun' tayo magkita

Hindi maalala, pero hindi sinasadya

Parang kapalaran, sadyang tinadhana

Nang dahil sa mga kanta (dahil ba sa banda?), tayo ay nagkakilala

Stanza 2

Biglang nainip, naisip kong sumilip

Kahit sa puyat mata'y napapapikit

Hindi mo na mapipilit, na lumayo ang pasakit

Wag kang magpapaakit (ano nga daw ulit?), ay teka! baket ka namimilipit

Pre-chorus 1:

Doon sa tulay, habang naglalakbay

Napailing sabay, napamura sa dighay

Chorus 1:

Ang tanga-tanga (amf amf amf!), ang tanga-tanga (ay pu cha!)

Yari ka yari ka, basag sa bakbakan

Ang tanga-tanga (amf amf amf!), ang tanga-tanga (ay pu cha!)

Ah basta ah basta! Bahala na si Batman!

Stanza 3:

Doon sa tambayan, tayo'y nagkukulitan

Ilang minuto pa, sige lang sa harutan

Tila naiinis, wag ka kasing makulit

Ang bangis-bangis! (Imba ba sa lupit?) Oh no! ika'y namimilipit

Pre-chorus 2:

Doon sa tulay, habang binabaybay

Pagkatapos mag-babay, napamura ang sambit ay..

Chorus 2:

Ang tanga-tanga (amf amf amf!), ang tanga-tanga (ay pu cha!)

Yari ka yari ka, classic ang bakbakan

Ang tanga-tanga (amf amf amf!), ang tanga-tanga (ay pu cha!)

Ah basta ah basta! Bahala na si Batman!

Bridge:

Eh ano naman kung nagbabadya, katotohanang mapakla

Hindi dapat mag-alala, basta sumingit ka sa eksena

Chorus 3:

Hala! Ano itong nararamdaman? (Ikaw yata si Batman)

Wag nang mag-alinlangan (Ako nga ba si Batman?)

Sa umaandar na sasakyan (Ikaw talaga si Batman!)

Sige na, iyo nang pag-bigyan (At ako nga pala si Batman)

Outro:

Ikaw. Ako. Ikaw at ako.

Ah basta ah basta, bahala na si Batman

Hagaran Base

2010-05-03T21:42:00.003+08:00

Halos para na akong nagbakasyon ng apat na araw simula nung biyernes ng tanghali paglabas ko ng trabaho. At ngayong araw ng lunes, idineklarang "non-working holiday" dahil sa "Labor Day" noong ika-una ng Mayo, at chamba na namang wala na naman akong schedule para sa trabaho. Iniisip ko na tuloy minsan na hindi na chamba ang mga nangyayari. At wag mo akong pagkakamalian, gustong gusto kong walang pasok kapag wala ring pasok sa trabaho o eskwela ang karamihan sa mga tao. Pero sa linya ng trabaho ko, una, hindi sabado o linggo ang wala kang pasok, pero ako, nasa akin yon. Pangalawa lang ang mga "holiday" na ito, at hindi pa pumalya simula ng mga "holiday" nitong taon katulad ng "Holy Week" at "Araw ng Kagitingan", wala rin akong pasok nun, pramis! At pangatlo, madalas magbago ang schedule ko, simula pa nung nagte-training pa lamang ako, pero eksakto palaging nagbabago bigla para sa pabor ko, as in! Merong ngang isang pagkakataon na hindi sinasadayang kailangan pa namin mag-extend ng oras para sa pagpapraktis para sa banda, eksakto na nagtext ang trainer namin noon na inusog sa alas-dos ng umaga ang training at hindi alas-nuebe noong gabi rin ng praktis na iyon! Hindi pumapalya! Salamat talaga Zhang-Ziyi.

At kaya, kaninang halos magta-tanghalian, pagkagising ko, sobrang init na, sobrang nakakatamad pa para gumawa ng kahit ano. Last resort: tambay at DOTA, ang makabago at napapanahong gawain ng mga batugan. Hindi na ako nagpatumpik-tumpik pa at lumabas ako ng bahay at tinungo ang pinakamalapit na computer shop dito sa amin, pagkatapos na pagkatapos lumamon ng pinaghalong agahan at tanghalian. Sa kalagitnaan ng pagdo-DOTA ko kasama ang iba pang mga magigiting na tambay, nawalan ng kuryente..

Ok sige, lumabas kame ng computer shop mga bandang 4:20 ng hapon, at lantarang tumambay sa daan. May isang nagyaya upang bumili ng "halo-halo", at pumayang ako. Sa halagang bente-pesos, presong pang adik, matitikman mo na ang 1/4 na litro ng langit at tipikal na pampalamig ng mga Pilipino kapag taginit. Habang nakatambay, nakikipag-kwentuhan, at ninanamnam ang pinag-halong tamis at lamig ng "halo-halo", isama mo na ang sustanya na dulot ng usok ng mga dumaraang tri-cycle, meron isa pang nagyaya na maglaro habang wala pang-kuryente at walang magawa; "Mataya-taya", ubusang lahi! Putcha nakakatakot! Ito ang karaniwang laro ng mga bata na "mataya-taya", yun nga lang, kapag may nahuli ka, kasama mo na sya para manghuli ng iba pa, so-on-and-so-forth. Bagamat kaya kong sumali, sobrang tinatamad talaga ako. At isa pa, naguumapaw na ang tiyan ko sa kabusugan sa "halo-halo" at iba pang mga masustansyang chichirya na nginasab ko ng bonggang-bongga kanina habang nanonood ng mga "videos" sa facebook. Pero, pinilit pa rin ako ng iba pa, at ako naman, nagpapilit. Ok fine! Sa aming dose, ako ang pinakamatanda syempre, ang iba pang mga kalahok ay nasa "late-teens" at "early-twenties". Sa simpleng mathematics, malaki ang tyansa na hindi ako ang magiging taya. At ang resulta, ako ang taya, isang kamote. Di hamak na mabilis din naman ako tumakbo, kaya binigyan ko ng partida ang iba para makalayo, at sa simpleng stratehiya na "survival-of-the-fittest" ko naisip na mahuli ang una kong biktima. Ngunit sa huli, nagkaroon ng dayaan sa "area-of-coverage", kaya ayun, wala akong nahuli, at nagdesiyon na akong bumalik.

Sa daan pabalik, may isang malaking patak ng tubig ang dumapo sa paa ko. Dedma. Ilang hakbang pa, isang malaking patak uli ng tubig ang dumapo naman sa balikat ko. Hindi na chamba. Tumingin ako pataas at nakita ang mga namumuong mga ulap. Mukhang dadamayan ako ni kumpareng ulan sa dinadanas ko na pagkatalo. Nang magtipon-tipon uli kame, may nagyaya ng panibagong laro; "Hagaran-Base". Isang laro kung saan ang layunin ng magkabilang grupo ay tapakan ang base ng kalaban upang manalo. Sa kalagitnaan ng masayang laro, sa kalagitnaan ng tag-init, at sa kalagitnaan ng krisis ng Pilipinas sa tubig na isang dahilan na rin kung bakit nawalan ng kuryente, umulan.. Natuwa ang isang kamote.. Gustong gusto nya ang ulan. Ilang saglit pa, bumuhos ang napakalakas na ulan na may dala-dalang malalaking patak. As in Imba! Ngayon na lang ulit ako nakaligo sa ganito kalakas na ulan mula noong taginit din, habang nakatambay sa magandang dalampasigan ng La-iya, Batangas.

Kagabi, nagkaroon ako ng panahon para makapag-isip, pagkakataong masagot ang karamihan sa mga tanong ko, at nagpatibay sa linya ng pagiisip ko hanggang ngayon. At tulad ng laro ng "hagaran-base", naisip ko na ang lahat ng tao ay mayroong layunin na tapakan ang base ng kani-kanilang mga pangarap. Mahirap man o madali, nakakapagod man o hindi, malalaman mong mas magiging masaya ito kung kalaro mo ang mga taong importante sayo.

Ngayon, kakatapos ko lang maligo. At mamayang alas-tres ng madaling araw, balik trabaho na ako. Isang panibagong pagkakataon na naman. Maraming salamat talaga sa isa pang tyansa, at nakakasama kita sa laro ng buhay. ^^

Light and Fluffy time

2010-04-27T00:47:00.000+08:00

I woke up at 5:30pm today with only about four hours of sleep, and I think I’ll be just fine. I slept once I came home from work, and it’s really scorching hot. But that’s so me, if I’m sleepy I sleep, but if I’m not, we’ll then I do not. Life is simple right?

I’ve been busy lately, and I’ve been in swimming twice last week, with just a day interval. One is a team building event from work, and the other one with friends. There is just one thing that’s stressing me out lately, “alak” (liquor). My body really can’t stand any sort of liquor, or anything that has alcohol content. And that’s also keeping me busy lately, battling with liquor. I think the worst case happened weeks ago wherein after I decided to drink that freaking “red horse beer” without holding back, I literally almost can’t remember a thing within that time frame. I even can’t remember how I got home. I just have image flashes on my head, and few scenes just like the movies. But not as harsh as how my friends would describe how it happened. They told me that I had been in a fight, but that is so unlikely. Yeah, I had my right eye sore, but later I realized, it’s just because of dirt or just because of the hot weather. But I think that is not the first time it happened. Since college, me and my classmates, whenever we plan on drinking, we plan it so we can sleep afterwards and rest at the comfort of the house of any one of us. I remember a scene in my head that one time, one of our classmates almost died from falling off the roof top because of shouting while giving the airplane that passes by a “dirty finger”. There is also a scene where we are all puking at the same time to a well of pig shit (eeewww, gross!). And I can also remember a time where we are in a room that we call BBB (big brown box), lights are out already, but I can see silhouettes of objects flying around because of throwing, and we are actually messing the whole place up, but we are not fighting. Those are the few things I can hardly remember because of liquor during college, but after school is a different story. Conclusion: I think I’m losing battles against liquor, but winning the war against mediocrity. It’s just “yes” or “no”. I really can’t drink, so I won’t force myself anymore. Now it’s just a matter of how I handle my convictions about my decision.

That’s just few of the things that’s in my mind right now here in my room, I mean, it’s not my room, but this is the place at the house where the computer is, and this is where I spend almost all of my time when at home. And I really appreciate my work schedule right now. Yes it’s just now that I’m feeling the effects of not sleeping in night time, everyday. But I’m fine with it because I can go to work at night, and still can also make time to do the things I need or want to do at day time, any day. But of course, proper scheduling and time management skills are needed on this one.

Right now, I feel good. It’s like I can do anything, but nothing at the same time. I can listen to music or to my favorite radio shows, watch TV, watch DVD’s, or watch series/anime. I can check on my social virtual life. Or I can also make “tambay” (hangout) with friends just outside. Or I can play DOTA or any game that I like. I can read books, write something or even draw something. I can play my guitar, practice. I even already organized my music sheets, but I haven’t backed up my computer files yet, and it’s been months already and I’m so running out of disk space, as in I’m down to MB (megabyte) already! Haha! But still that’s me, laziness kicking in.

Aaaaahhhhh freeee tiiimmmee… But be ready, more thoughts coming in…

Relax. Chill.. ^^

Forces of Nature

2010-04-21T13:48:00.001+08:00

I believe this is one of the forces I forgot to consider aside from Hearts and Minds. And in such a way that I think, this is one of what they calls, “Destiny’s” servant. What I mean is, you know at some point in your life, you'd think that, whatever you do, whatever happens, some things are meant to be? It even makes you smile when you see little signs of it, and it calms you down and makes you realize that in one way or another, everything’s going to be okay, and everything will work out just fine. At least that’s what I think. And there are many kinds of servants. I think I know it because I believe one is on my side, which is, although I’m a “kamote”, I have a strong sense of good luck in many ways than the other. And I’m very thankful of that. Time, on the other hand, I cannot identify yet.

Getting back to the point, wherein “again”, a question was formed in my mind;

Is there really such a thing as destiny?

War of Hearts and Minds

2010-04-12T22:55:00.001+08:00

Kinapos at nahuli na naman ako sa oras para sabihin ang dapat kong sabihin dahil sa dalawang salita o bagay na pinagtatalunan pa sa isip ko kung ano ba talaga dapat ang pamagat. Kung hindi man, sakto lang rin siguro para malaman ko kung ano nga.

Eto.

Lahat ng sinabi ko sa'yo totoo. Ibig kong sabihin ang lahat ng salitang pinakawalan ko. At kung ano man ang dahilan ko dati na sinabi ko noon, hayaan mong ulitin ko, na ganon pa rin ang dahilan ko ngayon. Ikaw na rin ang muling nagbukas ng natural kong isip. At ikaw din ang tumulong para bumangon muli ang puso ko at hayaang muling lumakad at magpatuloy.

Gusto kong maglaro. Sino ba naman ang ayaw? Masaya yon eh! Pero sa tingin ko hindi sa paraan na gusto mo. Ngunit hindi nangangahulugan na hindi ko ito kaya at hindi ko ito gagawin. Pinipili ko lang palagi na wag na. At bilang muling pagsalungat, binibigyan lang kita ng partida sa ginagawa ko ngayon dito. Kahit na naguumapaw ang tyansa na ako talaga ang talo. Ayos lang saken. Hindi naman ako nag-iipon ng panalo.

Gayun pa man, titignan ko na lang kung sino ang mananalo. Ang tigas ng ulo ko, o, ang tibay ng puso ko para sa'yo.

Sa'yo, tulad ng hiling ko dati, wag mong ipagdamot na ipakita ko ang nararamdaman ko bilang paghanga sa ginawa mo.

At para naman sa ikatatahimik ng naiisip ko, tulad ng nabasa ko dati, ibibigay ko na ang linya, "angtangatangamotalagaelmopakshetkaamf!".

Ano? handa ka na ba?

Ako, hindi pa.

Pero hayaan mo lang.. ^^

Supermassive Black hole

2010-04-02T04:43:00.002+08:00

Yan ang tugtog ko ngayon dito sa bus pauwi. Nakumpleto na naman ang sangkap ko sa pagsusulat. Nasa loob ng isang umaandar na sasakyan (sobrang partida), mp3 player, ballpen, likod ng notebook, at blangkong utak. At meron pa yata akong nakalimutan, isang usyosong katabi. Ayos! Game!

Ano nga pala sa Pilipino ang blackhole? Putcha. Basta sa pagkaka-alam ko, ang blackhole ay isang lugar sa kalawakan na kung saan ang isang araw o bituin ay nasira, at dahil dito, nagkakaroon ang lugar na ito ng isang malakas na pwersa upang hatakin, pilipitin, at sirain ang lahat ng bagay sa paligid nito, kahit ilaw o liwanag. Sa madaling salita, delikado daw pumunta dito. "Daw". Ang iba naman ay sinasabing sa gitna daw nito ay, maaaring, isang lagusan papunta sa isang partikular na panahon. Sauce! Napanood ko na to'! Ayawan na!

Pero seryoso, pinili ko pumunta sa isang blackhole ngayon. Maari naman ako manatili dito sa mundo at mamuhay ng matiwasay. Pero, ganoon pa rin ang dahilan ko, kung maganda man ang pupuntahan o hindi, naniniwala pa rin ako sa sinasabi ng iba na, dapat mong pahalagahan ang paglalakbay katulad ng pagpapahalaga na ibinibigay mo sa pupuntahan. At sa paningin naman ng iba pa, ang pagpunta sa isang blackhole ay isang malaking kahangalan at katangahan. At kelan ko nga pala uli inisip ang tungkol sa iniisip ng iba?

Sobrang hirap mag-adjust. Napakadaming dapat gawin. At napakadaming bagay na ayoko nang gawin. At mga bagay na ayoko munang bigyan ng pansin at gawin. Sobrang daming nakasanayan na dapat nang alisin. Para akong nagpapakamatay sa sobrang pagiging tapat sa sarili. At syempre kapag may bida, hindi pwedeng walang kontrabida, ang oras.

At oo nga pala, may isa akong nakalimutan sabihin dati sayo dito. Totoo ang chismis! Callboy na ako! Sobrang huli na ako sa pagsasabi. Hindi ko talaga lubos maisip at paano ako napasok sa ganitong trabaho. Ganoon pa man, nagpapasalamat talaga ako.

Masaya to! ^^

kamote to the MAX..

2010-03-17T18:46:00.003+08:00

Sa mga sandaling ito, isa lang ang tumatakbo sa isip ko..

Isa lang..

Isang tao lang..

"Lang"?

Oo pwede rin.. "Lang".

Pasensya na, pero..

wehehe.. ayoko sabihin...

siguro next time..

siguro!

~bitch mode~ ^^

Atlantis

2010-01-09T00:34:00.001+08:00

Yesterday I have a job interview which was re-scheduled to next Tuesday because of me and their dress code. Still having time to go to work, I texted my manager that I won’t come for work for that day anyway, and told her I do not feel well because of my headache from the activities of the previous day off. She understands and said it is okay. After visiting a friend in Market! Market! I went straight back home. Even though hungry, I did not eat my lunch. I just took a couple of “pandesal” from the kitchen, a bottle of water from the fridge, and head towards my computer upstairs. Because I do not like go to bed unless I’m really sleepy, I watched a few episodes of “How I Met your Mother” and “The Big Bang Theory”. At about 3:30pm, I felt sleepy. I drank the rest of the water from my bottle and go to sleep.

zzZZZzzzZzZzzzZ…

I slightly woke and looked at the wall clock, 8:30pm. I can hear the T.V. set downstairs, and thought to my self that I should get up and take a meal. But I don’t feel hungry. I decided to continue sleeping.

The “television”, I believe it is where my dream all began…

zzZZZzzzZzZzzzZ…

Me and my friends were watching anime’ when I noticed I’m already “in” the television, the one in the scene riding in the back of a water creature in the middle of the river, having fun, surfacing. Then someone grabbed me from the back and holds me so that I won’t be separated from the creature, which goes straight submerging. I panicked. I tried to force my way into letting go but it’s futile. The next thing was when I’m already in the bottom of the sea. I saw a woman and a child in a not so distant nipa hut, even though running low on air, I immediately swam to them. To my surprise, she’s talking to me and I don’t understand a word she’s saying. I thought to my self how is it even possible? Being that the case, still holding my breath, I made hand signs. I then hear her voice coming directly from her mouth saying, “just let go of it”. I still hold my breath, stopped and think. I go closer to her ears, chose my words, and few air escapes my mouth as I said, “no air”. But then I remembered I can only hold my breath underwater for 30 seconds max, and that’s without having any activity. After that it goes to my mind about the time frame when the sea creature dragged me down here, and the time I spent talking to this woman, which must have took 5 minutes or more. So I tried to relax, and breathed a little. Nothing happened. I tried to inhale again that as if it is air surrounding me, and not water. I did not drown. Then I breathed normally. No water entered my lungs. Not one drop. Amazed, I smiled to her. She just smiled back. Then a bright light radiates from my right. I felt drowsy and fell asleep.

I woke up in the morning lying faced down on the bed of the same nipa hut beside the sea shore. I looked into my right and saw the white sands and blue waters, and felt the warmth of peaceful ambiance. Then I looked to my left and found the baby lying beside me. I was shocked.

How is this possible? Oh yeah, I remember now! I was only dreaming!

The woman from last time stepped in and introduced her self as I rose up. She was “Addelle” and that was her child. Still having the questions in my head, I asked her, “Paano nangyayari to’? Nananaginip lang ako diba?” Again she just smiled and did not answer. Instead she let me carry her child and guided me outside. She introduced me to some people in the area. I even remember the one named “Badong” who toured me in the place, from which I told to him, “Ayos ah! Pareho pa tayo ng nickname!”.

From this point I had a mixture of dream, but still focused on the same story.

Realizing I’m still inside a dream, I got back to Addelle and asked the same question I had earlier, but this time, out of curiosity I added, “But how is everything so vivid? I know I’m in a dream but, how can I get back here in case I woke up?” She placed her right hand on my left shoulder and waved her left hand to the direction of a well. Understanding what she’s trying to imply, I said “Ayoko mauna! Ok sige, sabay na lang tayo!” She then hugged me and jumped into the well. We were swirling around, falling down, but in a slow, gravity-less motion. We ended up in a beach resort, somewhere familiar to me. She blends in the crowd and so do I. Looking around, I saw and old signage of the resort in the distance, which I already saw from before but I’m not sure where. Suddenly I felt the need to “pee”, so I searched for a bathroom. I saw a sign from a door that says, “Right Here!”, so I entered it. But someone noticed and told me I’m not allowed to go in there unless I leave the “potion”. Looking at the bottle of potions from a slightly opened door, I said, “Ok! No problem!” I get in and shut the door without having any idea of what he meant.

I opened my eyes and looked at the wall clock and saw, 4:00am. Then I closed my eyes and went back to sleep.

I found myself back on the beach, in Addelle’s hut. And she’s there. We talked about the situation while walking outside. We were both laughing in the middle of the conversation when her friends in an old car stopped in front of us and invited me for a ride. She told me I should go with them. Tipong “Boys Joy Ride” ba! Ok! Game! I hopped in. The next thing I knew we were driving really, really fast in the highway, on a swirling flyover! I even saw the “MegaMall” but re-designed. Futuristic. I realized, “Ano to’ nasa future ako?! Pucha kelangan ko magtanong!” Then they dropped us off. Me and the guy named, I think I heard something like, “Frye”. Cool! The car drove of. We were walking in the car park when Frye said we need to meet and fetch someone, then bring “her” home. We went upstairs and there she was, waiting. A beautiful girl wearing a violet shirt, purple polished nails, and wears a weird kind of violet eye contact lenses but goes gracefully with her beautiful face. I immediately introduced my self and asked for her name. She replied, “Isn’t it obvious?”, and then smiled. Then we went off. I noticed we’re headed for a private plane, 4 seater plane to be exact. For just the three of us.

I know it’s crazy, and that’s my dilemma. This whole thing is crazy enough to begin with.

Then I saw a bystander along the way. I really don’t know what happened but I just called her by the name and goes, “Cynthia, anong year ba tayo ngayon?” But again, for some unknown reason, she replied to me politely and said, “We do not keep track of the time nowadays but the last time I check it was already sometime between 2030 and 2040. As though I’m not shocked, I thanked her and waved goodbye. As I entered the back of the private plane, I found the violet wearing girl sitting there, and learned that Frye is our pilot! Geez! Things are getting crazier and crazier and yet my heart pounds with joy and excitement. As the plane took off, the girl beside me hugs my right arm smiling and said, “It’s Violet… My name is Violet.”

The next thing I knew we were back in Addelle’s place and I saw other people and planes arriving. I felt the need to “pee” and saw a wall. I walk toward its direction and urinated. In the middle of it I saw other people urinate other walls. As I’m finished, I turn around and walked the direction of Addelle’s hut. I saw her along the way, and out of excitement I shouted, “Yahooooo!!!”.

My alarm clock rings as I opened my eyes. It’s 7 o’clock in the morning. I need to prepare for work. Still lying down, confused about my dream, but smiling, I thought of how someone told about Atlantis. I don’t know for certain, but my two cents is that Atlantis can be found in everyone’s dream. And decided I should blog about mine! ^^

I’m a sleepwalker especially when I’m tired, but this time is different. I think it’s my, “Astral Body” that wandered.

One more thing, this afternoon while listening to the “Afternoon Cruise” on the radio at work, I heard the these lines in a song; “These dreams go on when I close my eyes. Every second of the night, I live another life.”

Once more, co-incidence?

Who knows!? ^^

Divine Tuesnight..

2009-12-16T17:41:00.005+08:00

It’s almost every Tuesday that I go to church, Greenbelt in particular, after work. And normally I would see few people, and that would be the best time to make “tambay” in church and make “katwiran” (I learned this from my college friend) to Him, which is the way I mostly talk to the Above, if there is. Other Tuesdays, they have charismatic gatherings, where once I found my self singing along. And last Tuesday, December 8, I was surprised when I saw many people, and there was a mass held. Having no choice, I just stayed and attended it. As soon as I got home, I asked my mom and my older sister what’s up and why there a lot of people in church that night. Because I normally see that kind of crowd, let’s face it, only during the first up to the third mass of “Simbang Gabi” and the other was “Misa de Gallo”, and the mass before New Year. Since I’ve been busy recently (naks! Parang artista ah!), I’m somehow outdated with the news and current events. Moreover, I sometimes actually forget what day it was. I didn’t know it was “Feast of the Immaculate Concepcion” that night until my sister told me about it.

Moving on, last night, Tuesday, after work, I found my self again walking towards greenbelt church, and thought it was a good time for a quiet moment. Since it’s a sort of a long walk, I put on my earphones from my phone, turned on the radio, and listen to “The BrewRATS”, a radio show composed of DJ Angel, DJ Tado, and DJ Ramon. I love listening to these guys especially when I heard that they also idolize “King DJ Logan (KDL)”, which is also one of my favorite radio jocks. When I reached the church, to my surprise, it’s as if I’m in the same scenario as last week, with almost the same number of crowd..

“Ano na naman to’!?”

I just stood at the same ground where I ask my self that question. Listening to “Our Father”, I removed my left earphone and retain the right to simultaneously listen to the BrewRATS where they have, “bring-a-friend-tuesnight”, and they have a priest guest, Father Francis (I didn’t get his last name), and their topic is about Christmas, and all. I noticed that he was cool and delivers good humor while conveying good information about the Christian life, particularly during Christmas. I’m learning a lot.

Benjie Mode:
(Benjie is an old officemate who knows a lot, and talks a lot at the same time. ^^)

“Did you know that Christ was born on 6 B.C.?”

I bet you didn’t.

Meanwhile, I heard the voice of the Greenbelt Parish Priest through the church’s speakers, and noticed his American accent. Intrigued, I moved closer to the church to take a closer look. That is the time he was just giving the final Blessing. Afterwards, he mentioned about the book “365 Days with the Lord”. I learned that he was a Filipino the time he spoke tagalog and cracked a joke about the book.

“Ayos ah! Ang cool ng mga Pari ngayon!”

By the time most of the people left, I entered the church and planned to buy the book and have it signed by him, the cool priest. Since couples of persons were lined up for the book, I decided to sit and wait. Still having my right earphone on, I continued listening to the radio. When I noticed the people cleared up and saw the priest is still there helping to distribute the books, I approached his assistant for one copy of the book, paid for it, and asks if I can have it signed by the priest, he said, “Opo, pwede po!”.

“Ayos!”

By that time I was already beside one woman standing next to the priest, but she was busy talking to the other woman on my back, so I got the chance to make an eye contact with the priest..

“Excuse me Father, pwedeng..”

Then I gave him the book along with my pen. He said, “Sure!”. While he’s writing on the book I mentioned my first name and realized he do not usually write names, maybe because he’s not used to signing books, but he wrote it anyway. Then the woman between me and the priest asked if she can, borrow my pen, and have her book signed just like mine, so I said, “Sure!”. After that, I asked for the priests’ name while reaching for his hand and placed it to my forehead. “It’s Father Mario. God bless.” Then I thank him.

As usual, I make “tambay” in the church for a while. Still listening to the radio, after about 5 minutes of browsing in my new book, I put it inside my bag and decided to go to Greenbelt Park to see the water fountain. I love fountains! In the pathway of the church, I turned around to my right, faced the altar, and gave off a sign of the cross. When I opened my eyes, I noticed in my peripheral vision that a woman on my right was looking at me. I did not mind her, and instead I turned around to my left. After a few steps, I took a peek at her to my left, and saw her once again looked at me. She is not the girl with the mark on her forehead (maybe I’ll tell you about that story some other time). I continued walking and sat beside the fountain in greenbelt. It’s about a few minutes before ten, and the show it about to end (the BrewRATS). I heard that they’re now accepting phone calls for any questions to their guest, Father Francis. Looking at my book I formed a question. Knowing I don’t have enough load for a call, I just texted them. By the time I sent my message they have just took a caller. Few minutes after the caller, I send the same message again. A moment later, I heard DJ Angel talking to the priest, “Father from the text line, Minsan may Isang Kamote is asking, where is the original Bible?”. Father Francis answered in details and said it was in the Vatican City, split up. After that, they asked the priest for a parting message, and gave their closing remarks.

Me, running low on battery, still managed to switch to mp3 mode on my phone, once again passed by the church going to the jeep terminal. That’s the only time I knew why there are a lot of people in church that night..

“I think I have just attended the first mass of “Simbang Gabi” this year.”

Sobrang lapit na pala ng Pasko, hindi ko pa alam.

Merry Christmas everyone! ^^

- minsanmayisangkamote

Go ahead punk! Make my day..

2009-12-12T01:53:00.001+08:00

Aside from having a strong “chamba”, and being lucky on the things I buy or purchase. And maybe aside from the good things I haven’t discovered of myself yet. I believe I have an eye for details because of, how do I call it, uuuhhmmm, let’s just say, good line or angle of sight, or in some occasions, awkward line of sight. To elaborate, based on a study (which I only made up), the normal or average of the worlds population, when standing up, have their eyeballs normally looking forward, straight, or at zero degrees. Me, my eyeballs would, most of the time, looking forty five degrees downward. Now, standing five feet and six inches tall, I find myself always in an awkward situation when talking to other people, especially girls, given that the average height of a Filipino woman is five feet, two inches tall. So just imagine which body part would I be normally looking at when talking to a woman. This happened many, many, how can I say it, many times.

There is this one time in my previous work; I’m talking to our receptionist and one of our consultants. This consultant was wearing “plunging neck line” that time. And pardon me, this is a compliment, she has a nice pair of, let’s replace the word and tag it, “shoes”. So being me, I didn’t realize I’m already looking directly at her “shoes”, while discussing something about work. In the middle of it, our receptionist playfully bumps me and said, “hoy san ka nakatingin!?”. Good thing the consultant just smiled, didn't mind it, and told us she’s used to that kind of situation given the size of her “shoes”. But I still apologized and said that I don’t mean to be looking at her “shoes”. Feeling that the apology isn’t enough, I told them facts on how I look at things literally, while her ending up telling us more stories, for example, in a meeting with men clients looking at her “shoes” intentionally.

This morning while riding on a jeep, and about to get stranded on a re-route in Makati Avenue (BTW, what’s the event in Makati today?), a gorgeous lady steps on. She is wearing a gray corporate blouse on top, a skirt (extra short), and black stockings, which I thought to be a BDO (Banco de Oro) uniform. She happens to sit “in front” of me and I “immediately saw” her, wait for it, brown eyes. Hey I know what you’re thinking!! We’ll get to that.. Now going back to the story, I’m curious if her eyes were real or she’s just wearing contact lens. Anyway, I constantly look at her eyes every time she pass my sight.

As most of the passengers dropped off at Greenbelt, people left in the vehicle can now be more at ease, including me and, ehem, the skirt girl “in front” of me. Having told you about my angle of sight earlier, it is now mixed with my “chamba”, when the driver had a “semi-rough break” of the vehicle, causing us to “semi-buckle up”. With that, just imagine how a woman in a mini skirt would react in that situation. But I saw nothing because of the lighting condition inside the vehicle. Being polite, I prevented of how things would go worse (or better in some other state of mind), by sitting sideward, and moving a bit backward. But as my “chamba” waves his magic wand onto me.. There it was! ♪ Hallelujah! ♫ The sunlight coming from my left, goes straight under her skirt! I said to my self, “I think I just saw her undies!”. White. But I don’t mind. Seconds later it happened again. That’s the time I realized it is “panty hose” she’s wearing not just stockings. But there’s more. Even with her black panty hose, through right amount and angle of light bestowed upon me ♪ Hallelujah! ♫, I still happen to notice the red star design on her undies! I can even tell which cheek it is on! (hardcore na to’!).

Mixed emotion, I don’t know if I should be disgust of myself, or just enjoy the moment. As it happened a few more times, I thought to myself that I ought to be doing something already, like telling her what I just noticed. And that’s the case; Should I be telling her? Again I’m confused. This always happens..

But the occurring things between me and the opposite sex is a different story.

Maaring mag-hilom ang mga sugat sa pamamagitan ng oras. Ngunit sa pamamagitan ng ano maaring mag-hilom ang mismong oras?

2009-11-23T22:24:00.002+08:00

Yan ang unang tanong na nabuo ng isip ko habang tuloy pa rin sa pag-karipas ng takbo ang oras. Habang ako, mahuhuli na sa trabaho, nangangamote, sa nakatigil na jeep na sinasakyan. Pangkaraniwan na Lunes ng umaga, inaasahan ko ang dagsa ng mga taong papasok sa trabaho. Mahigit sampung minuto na ang nakalipas, at tila isang tagpo sa pambatang palabas tuwing Linggo ng umaga, ang isang pagaspas ng hangin na may dala-dalang nagiisang dahon, ang dumaan paikot sa harap ko, kasabay ang katahimikan at mistulang pagtigil ng mundo sa loob ng tatlong segundo. At ayun, nagiisa pa rin akong pasahero sa jeep.

Nitong mga nakaraang buwan, maraming nangyari. Nandyan ang mga sunod-sunod na bagyo, kasunod ang baha, bagyo uli, isama mo na ang laban ni Pacquiao at Cotto, pati ang kaarawan ko. Basta lahat! At sa dami ng mga nangyari, sumunod ang mga tanong sa isip ko. Bakit nagmamadali ang mga tao? Para saan ang pinaglalaban ng mga tao? At ano ang pinaglalaban ng mga tao?

Sa mga nagdaan, hindi ko maikakaila ang mga sugat na natamo ko. Nahihirapan akong takpan ito sa pamamagitan ng mga ngiti sa mukha ko. Hindi ako malakas tulad ng iniisip mo.

“Manong bayad po!”

Parang walang patutunguhan ang mga naiisip ko ah?! Tae. Kaya ayokong nababakante. Pero wala rin akong nagawa, masakit man sa kalooban ko, nahuli pa rin ako sa trabaho ng siyam na minuto. Dahilan para bumalik na naman ang tanong ko kanina.. Papasimplehin ko ito ngayon..

May gamot ba sa oras?

Siberian Cat

2009-09-24T22:44:00.005+08:00

Every so often I go out for a stroll after lunch. This time, on my way back to work earlier, I came across this new pet shop in parksquare. This white-gray furred, silver-eyed cat on the window caught my attention. I decided to take a closer look. Since it seems like I’m inside my own world when I’m wearing my earphones for music, sight will be my primary sense. I noticed the person beside me pointing finger at the cat. As I looked towards her, I realized she’s talking to me. So I removed my earphones and started listening to her. She’s talking about the comparison between cats and dogs, and how she loves cats for the reason she described as, “hindi masyadong alagain”. I smiled and agreed. The conversation goes on..

While I’m in the middle of reading between gestures, I heard her say the term, “pang-kama”. Being the “grin-minded” I am, I paid more attention to what her saying. Just to be clear. The next she told me, “Maganda talaga siya “pang-kama” lalo na kapag kasabay mong matulog. Hindi katulad ng aso na kapag nag “se-s*x” kayo ng boyfriend mo, eh mangugulit pa yan!” That somehow scared me off. At first I thought of her as plain “tactless”. Then after a moment she once more mentioned the “s” word. My senses are now disrupted. Does this woman thinks I’m gay just like what most of people thought of me at first sight? Is she a hooker? Or, well, just another stranger you see everyday on the streets? I collected my self and said, “Sana humarap ung pusa. Gusto ko kasi makita kung magkaiba ung kulay ng dalawang mata nya e.” She didn’t respond. I didn’t bother to look at her for her reaction, scared thinking that the look in my eyes might betray and expose my thoughts. Then I remembered about the time. I think I only have four minutes. So I just made a final look at the cat, last glace at her, smiled (she smiled back), one step back, a partial wave, then I turned around to my left. No looking back, still confused, I smiled to myself while walking, I put both of my earphones back. ^^

Blue and Yellow

2009-09-12T23:51:00.001+08:00

I believe everything in this world is connected to each other. And I also believe that there’s always a reason for everything that happens. And sometimes, moments in your life come when you least expect it. Thinking of that, I took pictures of signage, bulletins, and even news I see in the streets, malls, and even in bathrooms, and upload it to the photo album I created in “facebook” named "I saw the sign". Some pictures are grabbed from other profiles, or anywhere that has to be related to the albums theme. It features irony, wrong grammar, wrong spelling, or something that can be hilarious or serious as compared to where it was placed, or anything that might have any connection to what’s happening (current events) or what I’m doing at the moment. I also do this when I need to think out-of-the-box. Basically, I just take a look around for signs.

Sometime in my past relationships, I felt so demanding, and wanted my partner to do this or that, be like this or that. I always looked for something. Then I heard the song “Blue and Yellow” from the (emo) band, “The Used”. The song goes, “well you’ll never gonna find it if you’re looking for it, won’t come your way”. I thought to myself, “can I answer that song with “papa don’t preach” of “Madonna”? Haha! Oh well, that song really taught me something.

The other morning, which I was really having a very rough one, I go to work, just like the usual. I put on my headset, connected it to my phone, and played a random mp3. Things got interesting when a song “Here we go again” by “Paramore” played. It just seemed like someone’s telling me something or trying to comfort me. Anyway, I ignored that thought and continue walking towards the jeep terminal. As I stepped in the jeep, my phone shuts down (battery problem). So I turned it on again and played the mp3 once more. While waiting for the random song, I looked and noticed the woman in front of me, and oh, am I in heaven? How could it be that an “angel” simply sits in front of me on a typical Thursday morning, in a typical place, and on a typical means of transportation in the Philippines?… Snap!! I got back to reality. But still, I couldn’t just ignore the beauty in front of me. The next thing that I noticed really got my attention. She’s wearing a “blue” sleeveless vest on top of a “yellow” tube (or spaghetti type) shirt. O… M… G!!! That’s also the time my phone played a song, and guess what, it’s “Blue and Yellow”…

Is this a dream?
Why can’t I take my eyes off her?...
…
I can feel my heart beats faster…
…
And faster..
... Geez, I think she just caught me staring at her..

Then my brain dominates over the situation. It said, “ Yeah right! You have just experienced one of the million coincidences that could happen! Remember, the whole world is a big coincidence”. Ok fine!

Suplado mode…

Yet once more, I stared, and got caught..

Oh well, I’ll just savor the moment. Now I’m caught between the thought of getting off the vehicle along with her and ask for her name, or, staying since I will be late for work. Then the jeep driver asked us (the passengers) to transfer into another jeep during the traffic stop sign for some reason (I don’t know)… And I got to sit beside her this time… As I’m guessing what perfume she’s wearing, I focused my peripheral vision towards her direction. I got so close to an “angel”, as her arms are almost on my back while she holds on to the window. Minutes later, she got off in front of PLDT in Greenbelt. Once again, my brain dominates. I did not follow her. My heart just gave off one big pump before going back to normal. But that one pump, threw a thousand questions for my brain to answer. But only one really pierced through:

“Will I ever see her again?”

..

I suppose.. (Answer to my friends so called "Psychology questions")

2009-08-09T00:11:00.000+08:00

The other night at around 8pm, I got home from work. Just before I eat dinner, 2 of my friends picked me up to a friends son's birthday party (2 years old I think), which I totally forgot we planned to. Wearing only my shorts and slippers, I changed for an appropriate shirt for the weather (may bagyo daw kasi), grabbed my umbrella, and off we go.

At the party, almost everyone of the "tropa" came, including "her" (I'll be using this, and "she", or "we" as a reference). "She", this "tropa girl" that I have a slight crush on to, ever since way back (I'm sooooo dead if she's reading this). I guess it's safe to say that we already go out once.. err.. twice... Alright it's thrice already!! But for me, i'ts just a "friendly date", I suppose. I just feel comfortable going out with her, watching movies, food trip, or do whatever what we thought of doing so. And that's it! Isa pa, kasama rin yan sa mga rules ko sa sarili: "Ang tropa, tropa!", in short, "hindi katalo". Nothing more I think. So alam nyo na!? So tigilan na ang mga somewhat "psychology questions" okei!? Although masaya rin, hehe.

Going back to the party the other night, "we" happened to share the same table together and we sat beside each other. It's a table for 10 persons I think. I was seated on "her" right, and there is this guy who sat on her left (We don't know him), and tries to flirt and hit on her every now and then. Everyone else of the tropa noticed it to. "She" always tries to ignore him by turning, and talking to me instead. Two of my friends signals that I should make "akbay" to her in an unnoticed manner. Ung tamang pasimpleng akbay ng mga torpe ba! But I just gave them a smile, and thought to myself that I should do this if the situation gets more serious. Everytime I noticed she couldn't turn to me, take her by the hand and ask her set of questions I normally ask to people, my own "psychology questions". But for "her", I made it in a form of a game. It's fun and she's consistent from the first time we did this before.

Then came the video-oke "trip". I really don't sing in karaokes, but i'm surprised myself how I got the high notes of "Fra Lippo Lippi's", "Light and Shade". And I believe I became an instant "video-oke king" that night. My other friend says "she" is "kinikilig" while I was singging, and every other moment I reach my hand on her face and give her the mic to let her sing. I now saw the other guy leaves. "Ayos Elmo!" says my other tropa, "pogi points!", and gave me an "ok sign". Anyway, nageenjoy lang naman kame. Wala rin naman ako balak magpapogi, so, sakto lang.

At about 3am, it seems to me that i'll be having trouble getting home this late, but I gave my "exit signal" to my friends anyway. Since most of them are drunk already, they agreed they'll be leaving with me, and we also have to ride "her" home. If I hadn't gone to this party, i'm probably be sleeping at home and had my alarm clock set at 6am for work. But this time they told me they will be sleeping over at "her" place, since i'ts close to the venue. And I think i'ts a good idea for me too so i said, "ok tara!".

At 3:32am, found myself sitting still on the living room, tired, and sleepy. I looked over to my "1 barred cellphone", and hell! I remembered "may pasok pa ako mamaya!". So I set it at 5:30am alarm and turned it off to save battery. "She" prepares her bedroom for the four of us. When "she" invited us in her bedroom, I directly go (sleep fast buddy! - true lies) and positioned myself on the sleeping mattress, for two persons, she set up on the floor, close to the bed (because the bed can only accommodate 2 persons). I made sure there's enough place for the other person who will sleep next me. I then hear "her" say while already sitting beside me, "dito na lang ako sa tabi ni elmo!". I threw a joke, "sabihin mo kapag uutot ka ha!". Pissed off, she slapped my left leg, smiling, "Kapal mo!". The tropa laughs.

..
..zzzZZZzzzZZzz..
...

5:30am.. "Fushigi Yuugi" ending theme plays....

ODK! It's my cellphone alarm tone! I woke up one of my friend sleeping on the bed and told him I need to go home and prepare for work. Having no choice, he escorted me to the door and I told him, "Hindi ko na "siya" ginising ha! Pakisabi na lang sa kanila mamaya.". He said, "Sige.", as I stepped out the door. While riding on the jeepney, having only about an hour and a half sleep, I had this crazy thought, "Hhhmmm.. If someone asked me if I slept with "her", I can give them a safe answer, "yes", right?!" Haha! Technically speaking, tama naman un diba?! Kamote mode na naman si elmo!! Whatever!^^

the best things in life are "guilt free"!

2009-07-22T22:42:00.002+08:00

after i punched out from work in our megamall branch, i went out for a little stroll. i first visited this boutique, btw which is one of my favorite, and planned to buy the "pink shoes" i saw from their other branch. after about 30 minutes of fitting, thinking, and asking the "promodizer" for a change of stock every time i see a minor defect, i decided to buy the shoes. holding the box, i looked around and saw this bag. i liked the the style but, judging from the material used, i thought it won't be so durable. so i asked the sales lady;

"ate excuse me, ano sa tingin mo, tastasin ba to'?" (while i was pointing to the inner lining)
she took the item from me, looked at it, and said;

"medyo sir, kasi...", wala na ako maintindihan sa sinasabi nya nung mapatingin ako sa super bebe na dumaan sa harap namen.. after five seconds, my "thought bubble" snapped!.. balik tayo kay ate sales lady..

"ah ganon poh ba? so ano sa tingin mo?", i asked.
"kayo sir..", she replied immediately.

not quite satisfied with her answer, i walked towards to the counter carrying the shoes with the bag anyway. keeping the thought of "i need a bag right now" winning the battles in my head. after a short pause, a little sigh, i now turn to the cashier, smiled and said hello. i handed over the items. i saw her remove the security pin (of the items) and punched it in. i heard two "beeps", but when i looked at the total amount, it was only for the shoes. quite knowing whats happening, i keep my mouth shut, and just pulled an amount of money from my wallet based on the total price i saw. i handed over the money. while repeatedly tapping the loyalty card at the desk, waiting for her to request for it (the card), i also, "partially", wait for her or her checker to mention that the amount of the bag amounted P0.00 instead of P599.75 after reading the barcode. a little bit of smile zipped out from me as i struggle to still keep myself from saying anything. anything!! fingers crossed, she now gave me the ("paid") items (haha), my loyalty card, and my change (ayos ah!), then said, "thank you sir!". when i heard that from her, i wanted to release another copied line from a radio jock, "nnnoooo, thank youuuuuu..", but of course i managed not to say so. instead i gave her a "sweet smile" (yung tamang pa-cute ba!). still not saying anything (malapit na mapanis laway ko. eeww.), a relaxed walk while still looking around, a poker face, i finally collected my "exit momentum".

out the doorway.

walked away from the store..

a little bit more...

...

then i found myself with a big smile, wanting to laugh my heart out while walking quite fast (still pressured?). i went to the department store first to buy shoe padding, and something funny happened there, quite "parental guidance", but maybe i'll tell you about that later. then i ride the fx going home. at home i told my older, and my younger sister who worked before for a competitor of the crime scene, (cough!), i mean the boutique, of what happened, and how i got the bag for free. but i got reactions such as;

"hoy badong kawawa naman un kahera, masho-short un!"

"naku hayaan mo na, kasalanan nya un!"

so i tried to explain to them my theory, based from what i know, that the cashier won't be charged. but just in case i'm wrong, i promised them, and myself, that i'll make a "notary to the public" through blog, just to lessen the guilt (hehe).

no i won't go back there and pay for it.^^

in my head, it's not my fault that the bar code has no amount, but i don't see any reasons i should be proud of what i did (of not saying there's something wrong to cashier).

but hey! i wonder why am i still smiling here at the train while writing this? hhhmmm.. looking at the heading of the newspaper here, let me ask, for you, the best things in life are..........?

chill. (^^,)

hhhmm... now what?...

2009-07-11T19:10:00.003+08:00

i promised myself that i won't blog until i have a new work (how irrational of me).. we'll now that i have one again, after being a bummer for 5 days, ano na? alam! ^^

ayun! txbk..

2009-04-25T02:50:00.005+08:00

gcng pa rn!

after the gig earlier, dpt ngaun on the way na kame ng mga offcem8s q to pinatubo!(para magpalunod sa lahar!!lol), para wla lng, hike-hike lng up to the crater and back.. d q pa natry yata un e.. d sana aq matutulog at direstso lakwatsa ng bonggang bongga! e kaso basa dw un mga trail e.. delikado dw para s mga hikers.. re-scheduled yta to nxt wik.. ayan sa sobrang lakas q sa ulan, umulan ng bonggang bongga, at umabot s hiking site!! e kaso sa nxt wik rn na rescheduled un swimming namin ng mga computer shop buddies q. ginamit kc un isa sa dalawang van n dpt gagamitin namen. bahala na si batman! kung san mas masaya n lng uli!! ^^

un gig naman kanina, i may say disapointed aq. since college, sa first band q, gs2ng gs2 n kasi namen tumugtog dun since maraming mga sumikat na banda na tumugtog at nadiscover dun.. at maganda daw dun! kaso ngaun, pagkatapos ng tugtog, ok lng, e kaso ang sagwa ng sound system e. un lng ang dahilan q, pero un na rin ang lhat ng magiging dahilan q rin kung baket ayw q na rin cgro tumugtog dun. kung discovery lng dn ang paguusapan ok lng cgro na hnd kame, ksi tumutugtog kame(or aq) dahil sa music, music, at music. expression through music. ngaun, hnd q naman naenjoy music dun kc sagwa ng sound system e. 1sang medyo technical musician term e un monitor, wala silang monitor para sa tumutugtog! kaya wala kameng marinig sa ginagawa namen! amf! (monitor ang twg dun speaker sa "harap" "stage" na "nakaharap" sa "stage", para marinig ng musician or singer un music nila, para matimpla nila kung ok na o hnd pa). or cge, i'll take back some, tugtugtog uli me dun, pero d na siguro me mageexpect ng sobra. tamang tugtog/hangout-hangout lng.. *wink*

pero overall, masaya naman ang gig, c/o 8daysaweekproduction, naks! maayos ang mga lineup ng banda, at eto pa, hiniram ng bahista ng prophets of memories ang bass guitar q!(fans nila aq e) but wait, there's more!!! next gig! tutugtog na uli sila, ehem, ayw q sabihin kung sino! wwweeeeeeeeeee!! makikita q na rin siguro kung ano pinagkaiba ng tugtog namin since nung binuo namin 2ng band kelan lng... sila kasi un banda na natandaan q since nung unang gig q sa band q ngaun, na pwde q gamitin as basis ng progress..

abangan!^^

oo nga pala, ngaun q lng din gnwa 2, 2 gigs in one week! ayos! mukhang mauubos agad ang leave q sa opis kung ganito ng ganito. pero may plan na me kung pano mag-adjust..

abangan! uli!^^

rock hard! (8days term)

Peripheral Vision

2009-04-05T00:07:00.004+08:00

Yesterday, 7am is the calltime for our company outing. At naalala ko, I still have the CD file that needed to be delivered to the client, from which I OT'd till 12am (same date). Grabe patayan un ah! So kelangan pa muna magtrabaho, and ask the driver of the van i'm assigned to, to go to the client's office first, and since kasama ung isang messenger namin, sya ang nagabot sa guard. Ay oo nga pala, yun ang tipo ng kliyente na nagpapa-revise up to the last minute ng deadline (tae. alam nyo na siguro kung sino kayo).

On the way to the resort in Pansol, Laguna. Paglabas ng SSH, since may motion sickness ako, naramdaman ko na ang pagkahilo. Kaso nagtataka ako, malapit lang naman ang biyahe, at ok naman ang aircon at smell ng van, normally kaya ko naman na i-endure yung ganon ngaun. Is it the the "puyat" from OT, or is it because I was on the backseat of the vehicle na sobrang ma-kalog? So natulog na lang ako, and saved by the bell, nakarating na kame sa resort. Since natural "hot spring" cya, kahit daytime e, mainit ang tubig (badtrip). Pero buti na lang may "pangpa-lubag-loob" ang pool na yon, dahil nanalo kame kagabi sa sa "pool soccer/basketball" game namin! 10 to 4 yata ang ending score! Haha! Tambak! Ayos! Mahirap nga lang mag-pwersa ng galaw kase meron kaming kakampi at kalaban na babae. Sa huli, wala naman akong nadale(sa pagkakaalam ko), kung meron man eh, "apir!". Sori naman!

Sa mga kakampi (team 2); Wham (power forward/malalim side), Paul (shooting guard/hari ng babaw side), Ruth at Mamu Tere (goalers/harassers), Ryder (center/import/tanker/MVP), at saken (point guard/pa-poging kamote); nice team play mga tol!

Sa mga kalaban (team 1); Kulas (shooting guard/boy sipa), Ed (power forward/boy kalmot), ruel (gwardia sibil), Fae (rebounder/elbow girl), Raizel (guard/aggressive splasher) Marian (goaler na palaging naiipit); nice game sa inyo.

Sa mga miyembro ng committee; Sir Lawin, Sir Randy, Ate susan; okei!

Good game (GG) sa lahat! Alam ko nag-enjoy din kayo tulad ko, although masakit ang buong katawan. At malamang tulog kayo sa mga oras na ito, at naghihilik pa dahil sa pagod! Ahaha!

By 11:30am earlier, we had to leave the resort, and eventually go for some touring/sight seeing/strolling/picture-picture in Los Baños (LB), c/o tourist guide Kulas. From Magnetic hill (sir randy optical illusion lang un pramis!), to Center for Arts High School, to Luntiang Bathala, na sinasabi nila na hindi daw pwede magpakasal dun kasi walang sacramento un (oooowwwsss!), at BTW, dun din daw nag-bisikleta si Regine sa movie nila ni Aga. From there, we went to the University of the Philippines, Los Baños (UPLB), seen the fertility three na amoy chlorox, had lunch in Rice Reasearch Complex, patakas feeding of the fish where there's a sign board that reads "Do not Feed the Fish", and lastly to DTRI (na akala namen T3), and sa bilihan ng pasalubong sa tapat ng Los Baños Water Station. During the tour, naisip ko tuloy na gusto ko sana pag-aralin ang mga magiging anak ko sa Center of Arts at UPLB.

Going back home, I end up in Market Market in Taguig (Roni, thanks for the lift). Since we passed by Cabuyao, Laguna, during the trip, I thought about the house that I bought in that province. Sakto sa Market Market lang nagtatrabo ang isa sa mga College tropa ko na nag-convince sa saken na bumili rin ng bahay dun tulad nya. Kaka-promote lang pala niya into Supervisor sa Department Store (oist jimmy, congratz uli!). So napagusapan na namin ang mga plano dun, kasama na rin ang tungkol sa iba pang mga ka-tropa. But co-incidentally, gusto na rin nya humanap ng ibang work (nak ng teteng!). Pero nakarelate talaga ako ng husto nang sinabi nya na, "Masyado malaki ang responsibilidad na hindi naman akma sa sweldo. At ayoko na rin ng trabahong masyadong ginagamit ang isip, kasi hindi naman consistent ang utak ng tao. Isang araw ang galing-galing mo, next day kamote ka!". May sense naman diba? Malufet ang Peripheral Vision ko, at lalo na, na kanina ko lang na-appreciate ng husto ang galing na yun and see such "beauty". Naks! Pero pagdating sa figurative na Peripheral Vision, good thing I have buddies to take care of that for me. Pinapaala nila saken ang iba pang mga detalye (sa gilid ko) ng buhay, habang nakatuon pa ako sa iba pang mga bagay-bagay.

At sa taas, thank you for surrounding me with such good souls.

Fail!

2009-03-29T03:03:00.001+08:00

Pero hindi rin!

Pagkatapos hindi gumana ng second hand electric bass na nabili ko from a friend of a friend, nangamote sa bagbaba at pagakyat ng stage at manghiram ng bass sa ibang banda kagabi, haha, ayos! Pinahiram saken ang five string bass! Yun nga lang, nakatahi ang strap, customized for it's owner. Since medyo payat sya kesa saken, hapit ang dating nang pagkakayakap ng gitara sken, at mataas ang hawak ko sa leeg ng gitara.. Ok pa rin yun! The show must go on! Eto pa malufet, syempre may kumukuha ng picture at video, isiping mo, naka-five string si Elmo! For the first time! Kahit naubos ang sampung minuto namin sa stage kaka-set-up, pinayagan pa rin kame ng production na kumanta ng tatlong kanta! (thanks Ice!) Ayos! Sa ngayon, nakatulog na ako, at naayos na ang bass ko. Tae, may nataggal lang pala na isang wire sa loob (Dodo, salamat sa pag-solder).

All-in-all, maayos ang naging takbo ng gig. Masaya naman lahat ng mga guest at tropa namen.

Eto naman na ang kasunod ngayon. Kelangan naman namen ngayon mag step-up..

Sa banda, sa gitara, sa sarili... Isa lang ang naiisip kong kailangan pa namen ma-improve. Although 3.0 lang ang nakuha ko ng college dito e, sa tingin ko ok lng to kase katulong ko naman ang mga tropa...

Chemistry.

damn...

2009-03-23T21:12:00.001+08:00

just when you thought you had a great weekend.

monday. 3:25am. leaving the computer monitor and the light on. back-pack lying on my feet. blankly staring at the ceiling. complete thoughts of the past, recent events, together with the dream the other night, unexplained, just suddenly strucked me..

another wave of images flash...

and another question mark...

damn...

...

regret...

shout-out

2009-02-23T00:55:00.003+08:00

So halos kaka-gising ko lang at maaga ang pasok ko mamaya. Good luck!Ok lang siguro, masaya naman kagabi. At eto ang mga naglalaro sa utak ko;

- 8 days a week production, astig kayo! Happy first anniversary! Keep the music flowing into your blood veins.

- ice, di ko sasabihin kung sino may crush sau! wahaha!

- 9 mile, nagustuhan namin tumugtog sa inu! malufet ang place nu, at ang daming bebe!(ayun un e!)

- prophets of memory, ok ang tugtugan nu! kita-kita uli tau! abangan namin album nu!

- prophets of memory lead guitarist, paarbor naman ng destroyer effects mu!(asa)

- the bayseeks, sana makita namin uli kayo sa "Dayo"! Di namin alam kung ngconfirm kau e. Crush q bassist nu!

- the bayseeks bassist, pa-surplus ka naman! Magturuan tau mag-bass! ahaha! kaso tulad ng iba pang mga crush q, di kita pwede kataluhin.(taena palagi na lang aq fighting the force of nature). lagi na lang may kung ano anong balakid. buhay nga naman ng kamote.

- the bayseeks drummer, kelan ba kau mgbe-break ng bassist nu?

- 5th day mystery, taena nu! isang praktis q pa lang kau nakakasama, sinalang nu na agad aq sa tugtugan! Pare-pareho tuloy tau sumablay! ahaha! ok lng, mukhang hindi naman halata. at may mga fans na yata tau.

- Clark(5th day mystery drummer), goodluck pare! Basta aasahan namin pagbalik mu! Gaya ng sabi q, siguraduhin mu lang na maipapasa mu na sa june ang nursing exam. (♦♫ scratch music effects ♫♫, ♫ tika lang, tika tika tika lang, tika lang ♫)

- Dodo(5th day mystery from rythym guitar to drums), taena ayusin mu palo mu! Kelangan naten galingan sa anniv ng 8 days.

- Chad(vocals), Neo(lead), ok lang yun mga tol! Karapatan ang tawag dun! ^^

- Ryan(rythym), hugutin mu na yan. Tugtugan na.

- Almuranas, ok ang tugtog nu nga pala last week. kaso pano kaya kapag umalis lead-ista nu?

- Brew-iw, ok lang. ay oo nga pala, mababa ang ceiling nu sa second level, sumakit mata q sa usok ng yosi.

- Brew-iw undergrounders, part lang din kau ng underground. kung naiintindihan nu ibig namin sabihin.

- Ale sa bus na tumabi saken, ok ka lang? Wak mu naman gamitin un pangalan ng nasa taas. At oo, nagsimba aq nung friday, at meron aqng ballpen! Oo nga pala, mga limang minuto ka na nasa cubao bago bumaba. Parang ewan lang. Dapat pala hindi q sinabi kung nasan na. mga tol, wak daw kau maingay! wahaha! peace!

- manong na pumalit, salamat sa direksyon.

- Jollibee heart center, init sa store nu!

- manang sa tapat ng jollibee, salamat sa balut!

- at sa sarili ko, naipahinga mu na un mga daliri mo ngaung araw, praktis na uli. Eksakto ang mga nangyayari, mukhang oras na para tanggalin ang mga kalawang sa kamay mu. Naririnig mu na ba uli ang metronome? Batong-bato ka na ba? Rock-rockan na! ^^

♫♫ Come-on!♫♫("wake up" by "rage against the machine","the matrix" OST playing on the background)

hhhmmm....

2009-02-19T15:38:00.002+08:00

One of my "labo-labo" goals for this february was to create a song or a poem atleast about that four letter word that we call "LOVE" (love song for no one amf!). But I just suddenly lost inspiration or maybe "nangamote" lang talaga ako. I was searching google for something that i needed here at work and I stumble on this particular site(blog) that's so unrelated to what I searched for. Most probably many people already read this story. And I believe the author just copied this story from somewhere else and just share it. I'll do just the same...

An Island of FEELINGS

Once upon a time, there was an island where all the feelings lived: HAPPINESS, SADNESS, and all of the others including LOVE.

One day it was announced to the ‘feelings’ that the island would sink, so all repaired their boats and left. LOVE was the only one who stayed. LOVE wanted to persevere until the last possible moment. When the island was almost sinking, LOVE decided to ask for help. RICHNESS was passing by in a grand boat.LOVE said, “RICHNESS, can you take me with you?” RICHNESS answered, “No I can’t….there is a lot of gold and silver in my boat. There is no place for you here.”

LOVE decided to ask VANITY who was also passing by in a beautiful vessel, “VANITY, please help me!”“I can’t help you LOVE, You are all wet and might damage my boat,” VANITY answered.

SADNESS was close by, so LOVE asked for help, “SADNESS let me go with you.”“Oh…LOVE, I am so sad that I need to be my myself!”

HAPPINESS passed by too, but she was so happy that she did not even hear when LOVE called her.

Suddenly, there was a voice, “Come LOVE, I will take you.” LOVE felt so blessed and overjoyed that he even forgot to ask the elder’s name. When they arrived at dry land, the elder went her own way.LOVE, realizing how much he owed the elder, asked KNOWLEDGE, another elder, “Who helped me?”

“It was TIME”, KNOWLEDGE answered. “TIME?” asked LOVE. “But why did TIME help me?” KNOWLEDGE smiled with deep wisdom and answered, “Because only TIME is capable of understanding how great LOVE is.”

fall out valentines?

2009-02-14T10:41:00.007+08:00

And yes it's the day of hearts again..

And what did you say again, you are at work right now? Yes i'm spending my valentine morning here in the office, working("working", yeah right!). It's ok because last night I ended up going to Araneta for the concert of "Fall Out Boy".(Fae, thanks for the invitation!Lufet!^^). I remembered when i'm a personnel in the main warehouse of mercury drug, where i used to work there as a traffic officer and have the authority to operate the paging and sound system of the whole warehouse. I played "Sugar we're going down" for the first time while tuned to NU107 from fm radio. Good thing I have buddies there that are in-the-know of what are the new bands to listen to, and fall out boy was one of them at that time. And hey, they liked my music for that afternoon. I liked FOB the first time they got out, but suddenly they changed their genre of music from adult-alternative to, I think pop, for the reason I don't know. Then i stopped listening to them. So last night I thought I'd be just listening for their new music(pop) and just enjoy, next thing i knew, I was singing along because they played songs from their old albums. Yeah bah!(^^,) I heard Nica said(a friend of a friend) after the concert, "tatlo lang ung kinanta nila from their new album", and I thought, "aaaa, kaya pala nakasabay aq". Saya!

Balik sa valentines day @ work, I should be getting out here soon, and find my Winona.
^^

Wala lang.

2009-02-04T00:24:00.004+08:00

Kumalog ang jeep. Naramdaman ko na ang senyales na malapit na akong bumaba. Inangat ang ulo mula sa bag na nakapatong sa dalawang tuhod. Dinilat ang mga mata. Tumingin diretso sa harap at inilagan ng tingin ang nasa harap na pasahero, tinignan ang kalsada, ok! Tumingin sa likod, ok! Tumingin sa kaliwa nakita ang kasunod na jeep, at nakita ng malaking board nito sa taas, "Katas ng Saudi". Tumingin sa kanan habang inilagan ang tingin ng driver mula sa kanyang rear-view mirror(oi manong nagbayad ako ha!), nakita ang crossroad, ok! Pwede na. Sinamantala ang nakahintong trapiko.

Elmor: Kuya saglit lang po!

Narinig ang aking senyales, bumaba ang lakaki na nasa tabi ng pinto na kanina pa nagdadalawang isip na bumaba, na kanina pa nakahakbang ang kaliwang paa sa unang baitang ng hagdan. Bumaba siya. Sunod na ako. Pagbaba..

Elmor: Hayz!

Bagsak ang balikat. Tumigil ng dalawang segundo para tumingin sa paligid(at magpapogi! jowk!). Isinukbit ang kanang strap ng back-pack sa kanang balikat. Tumingin sa kanan, tumawid. Lakad. Lakad. Nakita ang telebisyon mula sa isang electronics shop, nakabukas. Tumigil. Ang ganda ng artista na yon ah! Inalis ang tingin sa T.V.. Tumingin sa daan. Naglakad habang isinasabit ang kaliwang strap ng back-pack sa kaliwang balikat. Naglakad.
Pagdating sa kabilang kanto, sa ilalim ng "Arko", gilid ng daan, nagtitipon ang mga tao. Meron sa kanila ang may hawak na kandila, un iba nakasindi at ung iba hindi. Yung ibang tao, "Uzi". Tumingin ako sa kabilang kalsada, sa ilalim ng "Arko", sa gilid ng daan, ganun din. Pero sa pagkakataong ito, may "bebe"! Kaso ang layo. "Dedma" na lang. Tumuloy ako sa gitna ng kalsada, maluwag. May tumawag sa gilid..

Tita Jean: Manedyer!
Elmor: Ow? Sakto! Ano meron?
Tita Jean: "Prosisyon"! Tagal nga e! Sama kame.
Elmor: Aaaa... Sige, dito na me!
Tita Jean: Ok, sige!

Lakad. Lakad. Pangatlong kanto, tumingin sa mga tropa sa harap. Bumagal ang lakad. Namulsa(dalawang kamay). Nagpapogi ng lakad. Ilang hakbang pa..

Millard: Hi Elmo! (lumapit, at payakap sa kaliwang braso ko)
Elmor: So ano, bukas, tuloy? (ngumiti habang tinanggal ang kaliwang kamay mula sa kaliwang bulsa upang pasimpleng makawala ang braso sa yakap)
Millard: Di ko sigurado. Wala akong pamasahe e! Sama ka ngayon!
Elmor: San? (nakawala na, at bumalik sa pamumulsa)
Millard: Sa "Pinagbuhatan", dadayo. Kasama ako sa lalaban.
Elmor: Aaaa.. Ganon? Dito na lang ako. Mamaya sabihin mo saken kung sigurado ka ha!
Millard: Ah ok! Pahiram limang piso... sige na!
Elmor: Hiram to ha! (asa ka pa! malayo sa katotohanan ang ganyan!)
Pompi: Clan Lord! Sama ka! (pasingit na sigaw)
Elmor: Hinde sige ok lang ako dito..

Ngumiti. Tumalikod. Naglakad. Pumasok sa iskinita. Medyo madilim.
Nakayuko. Lakad. May pasalubong na naglalakad..

Taurus: Fafs! Elms!
Elmor: Ow! Dadayo sila ha! (hindi tumitigil sa paglalakad)
Taurus: Oo nga e. Sama nga ako e! (papalayo na ang boses)
Elmor: mmmmm...

Lakad. May kasalubong uli..

Elmor: May laban sila ngayon sa pinagbuhatan ah! (hindi pa rin tumitigil sa paglalakad)
Jade: Ganon? Tignan ko. (palayo na rin ang boses)

Lakad. Liko. Lakad. Nakarinig ng kanta sa dinaanang bahay..

(radio): "sabihin mo na... kung babalik ka pa.. para di na maghintay..."

Napamura sa sarili, "taena emo na naman".
Lakad. Liko. Lakad...
Binuksan ang gate. Pumasok. Napansin na may humahabol sa pagpasok. Habang sinasara ang gate..

Elmor: Hi Bubbles!
Bubbles: Meow!

Bakit nga ba?

2009-01-30T00:57:00.003+08:00

Earlier in my workstation at the office, an officemate, who is proud to be an AE, had to borrow my thumbdrive to transfer some files from her laptop to our IT support's PC which is infront of my desk. She plugged my thumbdrive and saw it named "kAm0TE". Out of curiosity, and since it was one of my popular nickname in the office, she asked me, "baket kamote? ha elmor?!"

Hhhhmmmm... HHHHHmmmm...
aaaaa....
....
hhhmm..

Baket nga ba?! Parang ngaun ko lang naisip na na-dedma ko sya kanina ng mga ilang segundo habang nangyayari sa isip ko yang mga letra at tuldok na yan(sorry addie :P).Everybody have had a "kamote moment". It could be anything. For example, when a student doesn't studies his lesson well and you see him scratch his head during exams, you'll know his already having his own, fresh na fresh, straight-off-the grill, mainit-init pa, "kamote moment". Or if i'm wrong, the answer is "clear", no dandruff!, mag memo-plus gold ka na!(maybe i should get paid for these advertisment?! nah!). As this thought keeps on revolving inside my head in guadalupe on my way home, i accidentaly stepped on a big.....wait for it... big trash pan! The next thing I know, an avalanche of garbage splashed up to the back of my knees, staining my pants. Anak ng tinapa, kamote moment na naman on the spot, at parang tinapa rin yata yung isa sa mga nakita ko na tumalsik sa paa ko! Anyway, when I was in gradeschool, "nangangamote" rin ako sa exam, pero hindi tulad ng "pangangamote" ko kapag mga kaklase kong babae na ang magsimulang mang-asar. For some unknown reasons, since bata, pwede kang "makipag-suntukan" kahit sa mga babae, at panigurado papalagan ka rin nila! Kung su-swertehin ka pa ng konti, e baka ikaw pa ang magulpi nya! Pero parang hindi ko trip un. I remembered kapag nagsusumbong ako sa parents, tito, at tita ko,(loser, sumbungero! haha!) they would say to me, "Halikan mo! Krass ka lang nun!", Ayos un ah! Kaso lang, baka mas malufet pa ang makuha kong jackpot kapag ginawa ko un e! So hindi ko na rin tinangka.(ok lang un, makaka-score ka naman!). At isa pa, sa isip-isip ko, ok ka lang?! Suntukan?! Crush?! haller!!?.

Pause...

(on the phone calling to a radio station)
-aahhhmm.. hello?
-yes, hello!
-aaaa, pwede po bang bumati?
-sure! go ahead!
-hhhhmmm, binabati ko po lahat ng mga naging classmate ko nung elementary especially to Kristine, Mercedes, at ung isa pa na sarap-to-the-bones mang-asar! Hello poh sa inyong lahat! oopppsss... aaaaaaaaa... can i pass the phone?(haha! old school!)(uy, literal un ah!)

Continuation...

Early highschool, nag-improve ang pangangamote ko! Parang hindi ko alam kung maganda un o hindi ah! Well, all i can say is, malakas talaga manghiya ang mga babae! amf! A basta, lahat tayo may mga kamote moments! Pero yun din ang saya nun e! Atleast hindi ka rin perfect! Atleast alam mong tao ka! Atleast alam mong nabubuhay ka! Sarap kaya non! Parang kanta..
(*singing*)
"yeah you bleed just to know you're alive! and I dont want the...."
....Ok tama na! Napansin ko lang, bakit ang-"emo" ng dating kapag ikaw ang kumakanta?Ewan ko sayo. Bahala ka mag-isip.(nice ric!).

When the time comes that you'll be leaving this world, when you're already in heaven, or hell, or kahit saan, o kung ano man ang paniniwala mo... Pwede mong sabihin, na sa sarili mo, minsan may isang kamote...

Fill in the blanks;

2009-01-27T01:00:00.004+08:00

This coming thursday there will be a training(btw, every thursday and just started last week) in our office themed "undepartmentalized creativity". I have always liked to think like this, but i realized i'm not asking this myself anymore recently. And now, i'm sensing "or" hope a lot of this will "come out"(and oh! I remember! "off my head"!) on these coming days. Anyway here it goes...

"What if ____________?"

nosi balasi?

2009-01-13T01:12:00.003+08:00

1. mali naman un e. dapat, "alisabonis". pagbigyan, new year naman.
2. hindi pa rin ako makatulog.
3. ano ibig sabihin ng salitang "kalayaan"?
4. nakakainis hindi ako makapagpasaway(or simply be the kamote i am). hindi tuloy ako makadiskarte. konting bwelo lng.
5. kahit makapagbigay lang ng opinion pwede na.
6. everyone make mistakes, why can't i?
7. no room for errors. eksakto may nadaanan ako kanina, "room for rent".
8. o hindi ko lang talaga kilala sarili ko? o un nasa paligid ko?
9. nosi balasi?
10. sino ba u?
11. txbk.

Imperfections. Differences. Conflicts. Tranquillity. Ulit.

2008-12-21T19:08:00.003+08:00

From my point of view, it all started with *imperfections. I read somewhere, "Nobody can be perfect, but only in grammar". Fine! The point is, show me someone who's perfect(generally), and i'll tell you how to stop time. Malabo ung example, pero sana na-getz mu.
Moving on, because of imperfections, follows *differences. I believe someone told me that there are only 7 or 9 types of people. And once you know them, it's like you already knew the whole world. Sarap siguro nun! Hhhmmm.. Let me check.. I just came earlier this morning from a slumber party. Nahh! Sosyal ung term e! Erase. Last night me and my college buddies got the chance to hang-out again. We drank, and as being me, after my third shot of that freakin' Generoso, i now have fill-in-the-blanks memory. It's ok because thats what we do. When we drink, we stay in the place until we are sober. Then I woke up this morning with a smile when i heard one of my tropa greeted my another tropa's(the owner) mother, "Tita good morning po!", and got a reply with a jolly voice, "magandang umaga mga lasenggo!". Haha. Wait, getting back to different types of people.. From college, there is, a classmate who hates ROTC but now a 2nd Lieutenant in Philippine Army. A Cumlaude who now works at the government(or dati "cum"-laude!wahaha!Fine, hindi na namin iku-kwento kung sino namunas!Peace!). A genius who now teaches in a public school along with old teachers(yikes!). A happy go lucky who recently quits his job(but still happy). A late bloomer kamote who, now, is still a kamote(saket naman nun!). A grumpy, lakas trip, at the same time a cool dude as a supervisor of a department store now. From competitive in sports to a bank employee. A colleague who took accountancy who now works as a, well asa ka pa, an accountant in a mall. Hhhmmm.. Wait, sa work naman! There i have, jolly persons, smart, creative, witty, talkative, silent(but deadly parang utot!), bullies, chismosa, a person who takes everything seriously at nagpapa-apekto sa chismis(sana ok lang sya ngaun), playing safe, may sariling mundo, walang pake-alam, may pake-alam, paki-alamero, palikero(palengkero, panadero, pasahero, sirkero, bosero, kaskasero, motorsiklo, ibang siglo, lolo, lolo mo!), may tao na puno ng buhay, walang kabuhay-buhay, mababaliw ka sa buhay(pero astig un tao na tinutukoy ko na un!), buhay na buhay, at nawalan ng buhay(kapag friday night, dahil sa sobrang O.T.! Wahaha!). A basta! Marami talgang klase ng tao! We are all different in our own litte ways.
Now from differences, there comes *conflicts(eto na exciting na!). It's inevitable for us as human beings. So kagulo na. From what i understand in a part of Christian Bible, There was a time when we only had one language. Once there was a tower built, it's aim; to reach the sun. It's name; "Torre ni Babel"(Hoy mga bakla shaddap! Hindi ito yung iniisip nyo! Mga gaga!). But, the Creator(of the universe), kind of didn't like the idea. So what he did was, from being one, the peoples language was changed and became different from one another. There was conflict. Tower of Babel fell down. Time warping, the first world war has already happened, and then came the second. And now who knows when might be the third occur.
Now it's december 2008. I had a quite good november, but december, i'm starting to hate it. I really don't know why. Maybe because of the conflicts at work(rush rush rush, for the vacation), panic buying, crowded malls and streets, gift thinking for inaanaks(considering i don't do gifts). But I love the weather. Until the Priest's homily from the Mass held in our office just before the Christmas party last friday made me realize something. I don't know exactly what he said, but he mention something in relation with our heart. And once you let(accept) "that something", you'll know it(feel it). I hope everybody knows the true meaning and feel the spirit of Christmas. And I also hope not only for this season. Ok! At the end of the day, there will always be, one way or another, peace and *tranquillity.
It all boils down to this, as history repeats itself, as there was a boy and a girl, if there's a man there's a woman beside him, if there's a will there's a way, good and evil, heroes and villains, Vilmanians and Noranians, toyota and crispa, Jack and Jill, me and you(naks!), lightning and thunder, tokwa't baboy, dinuguan at puto(gutom ka na naman!?), spaghetti and cheese(lactose. i'll pass for now). And so as, "Night and Day". It will all happen again tomorrow. Are you ready? *Ulit.

Buhos ka ulan...

2008-12-12T09:30:00.003+08:00

..aking mundo'y lunuring tuluyan..-eheads
was played on the public jeepney we we're riding, that time when we have the same rain as now and probably the same time, when classes were cancelled due to storm signal # 2. Since it was highschool, me and my classmates(and schoolmates), would always hangout to someones house afterclass just to, well you know, chill!(naks!). I remembered when we got to a schoolmates house, she said, "O, relax lang kayo ha! Feel at home!", as she sit on the couch, grab the T.V. remote control, and turn it on. Her brother, who was a C.A.T. officer(they are on the same school level by the way), just go and find something to do in the house. As for me, i just, hhmmm, wala lang! My girlfriend, that time, cut my fingernails, never knowing she was cutting them too short they would bleed(ouch!). One of my schoolmate, who was also a C.A.T. officer, just go straight to the kitchen and find something to eat, for himself(partida hindi nya bahay un ah!). The rain ceases for a moment, we go outside to buy bread on the nearest bakery. I believe it was that time when i first had the favoritism for "ensemada" and "spanish bread". I wonder if that bakery is still open up to now. Syete! dapat kasi nag-almusal muna ako bago pumasok sa work! puro pagkain tuloy naiisip ko!(lagi naman e!)

Ulam! Alam! Hamog!

2008-12-02T23:28:00.000+08:00

Yesterday, when I came back from Batangas, and Cavite as well, I spend the whole afternoon sleeping. Then when I woke up at around 5pm, I just lie down on the bed, then got up to eat, then lie down again, then sleep again for the next day's work. I just felt so lazy. Feeling ko para akong baboy na pinapataba na malapit nang katayin! Maybe the reason was when I said that we can catch fish and crabs in Batangas, but, I got colds instead during the last night of stay, where we had dinner infront of a bonfire by the bay.(*sniff). It was a very very relaxing 4 days & 3 nights vacation, especially, one mid morning, i just lie down(and lie face down occasionally) by the bay, underneath a semi-cloud-covered sun, closed eyes partially waiting for the rain(because I heard there was a storm somewhere), feeling the fused heat of the sun and sand, mix with a cool breeze of air, and listen to the relaxing wave of water like a lullaby. Then, when I open my eyes, I had a red-blue-ish vision, look to the seemingly endless line where the sea and sky meet, inhale a deep fresh salty air, exhale, then ask myself, "Ano kayang masarap makain ngayon?!". Solve! Also, I did mention that we will be going to Lian, Batangas. But up until now, i'm still wondering how did i knew about the place, wherein, it was my first time to be there! The place that I was referring to before, was supposed to be La-Iya, Batangas. Demmet! Anyway, also during my stay, I spoke to this middle aged Batangeña, and told me about an old lady that she came across the other day, where she described her(wearing a "Batangeño Accent") as, "Aba e! ka-nuknukan rin pal-a ng bingi yu-on!" and continued with the story. As she pass by this old lady, as a courtesy, she excuses herself and said(still in "Batangeño Accent"), "..'Nay! Makikira-an 'pow!..". But, she was shocked as the old lady replied to her(with ofcourse, "Batangeño Accent"), "Wala kaming ulam!".

Ano!?

2008-11-26T22:24:00.004+08:00

Ok fine! Sabi ko nga nandito pa ako sa Manila!
Major change of plans.. Who would've thought, that freakin' travel agency guy won't give us our plane ticket.. Leche, excited pa man din ako sumakay ng eroplano. Well i'm not so surprised as this usually happens to kamote people. But! No worries kasi malakas pa rin talaga ang chamba naten!(Ayun oh!) Since nabanggit ko na rin ang Lian Batangas, co-incidentally, dun ko lulustayin ang aking VL(vacation leave) na muntik nang masayang. Ala eh! Pagkakataon nga naman hane?! Magiging malapit na naman muli ako sa kalikasan(but not the usual "tawag ng kalikasan"), wherein we can go fishing and catch crabs, and go swimming as well, simula mamayang umaga hanggang linggo!(buti na lang rin walang pasok sa lunes!) Pwede?! Pwede!!
Setting aside the frustration, and wearing a smile instead(as usual), and living each and every moment of life as though it is your last('cause one day you'll be correct.. nabasa ko lang yun!) is a fun thing to do after all! Try it! (^^,)

Checklist

2008-11-26T02:43:00.007+08:00

- Shirts; Check!
- Pants; Check!
- Shorts; Check!
- Short-shorts; Check!(pa-pogi ang hanep!)
- Underwear; Check!
- Sunblock; Check!(kahit sunog na)
- Goggles; Check!
- Salbabida na gawa sa interior ng gulong ng truck; Check!
- Towels; Check!
- Shampoo and conditioner; Check!
- Managers; Check?
- Post dated; Check?!?
- Enough of that! Check!(aayyyy! papannsssiinnnn!)
But seriously, what's up with Boracay?! More importantly, what's up with people calling Boracay, "Bora"!?(did i just sounded like DJ Mo Twister back there?). Diba? Pareho lang din naman na may white sand dun na pwede mong makita sa dulo ng Batangas na katulad ng sa Lian(uuyyy, namimiss ang Balai)! Pareho din naman ang tubig na sinasabi nila na kaya maalat ay doon umiihi ang mga nagsu-swimming!(bakit nga ba maalat ang dagat?!). Ah ewan! Malalaman ko na lang siguro dun un! E kaso, kanina lang may balita parang "usapang-lasing" ang ticket e. Wag naman sana. So pano, mukhang hindi muna kita makakausap sa loob ng ilang mga araw. Until next time!!

Sealed and Delivered,
xo xo Kamote Boy
(Oo tama ka! Sa Gossip Girl nga yun!)
Isang episode pa lang ang napapanood ko e. :p

adik!

2008-11-23T00:55:00.003+08:00

Oo! Adik ako!... Sa tulog... Ang hindi ko lang maintindihan, bakit di pa ako makatulog? kanina pa ako nanonood ng kung ano-ano at ngdodota. Halos wala din akong tulog, pero gaya nga ng sinabi ng isa dito sa shop, "ok na yung wala kang tulog, kaysa naman sa wala kang gising!". Wahaha, akalain mo, may sense din pala ang kumag! Pero siguro, marami lang talaga ang pumapasok sa isip ko... Tulad ng; trabaho, mga plano sa pasko, mga foodz na masarap chibogin, kung burger ng jollibee o burger ng mcdo ang mas masarap(kasama ba talaga yun?), mga trip na pwedeng gawin... Tama! Ngaun linggo na nga pala yung trip namin sa boracay noh? Hindi kaya excited lang ako? Ok lang... Hindi lang talaga ako siguro un tao na gala. Oo, gumagala din ako, pero madalas bahay, office, bahay, office, simbahan(naks! parang totoo ah!), bahay lang ang scenario sa buhay ko e. O hindi lang talaga ako kumportable sa plano sa pagpunta sa boracay.. Malabo din kasi ang mga plano e. Maraming nababago. Yun' nga lang, mas nakakaexcite kapag hindi mo alam! Whatever yaya! :D

thunder only happens when it's raining

2008-11-21T11:46:00.002+08:00

Last Song Syndrome(LSS), from mag:net in high street last night(compliments to ma'am angeli, the birthday celebrant who sang the song), to earlier when i wake up, to even here in my work. I really love the rain. It's 8:00am, not to mention my work is at 9am, when the sound of the rain woke me up, and shoot!, i need to hurry! And as usual, along with it are thoughts in my head i can't convert into words. In short, another kamote moment.
I just remembered, my kamote fs..
www.friendster.com/ejkamote

horoscope ka pa?

2008-11-19T11:40:00.002+08:00

Ok, fs horoscope said i might feel left-out on a secret today. I say, hell too much for 11:45am. Na-chambahan yata ako ah. Ok lang sana kung pagusapan ka e, kaso, parang iba e. Putting words in my mouth and putting thoughts in my head are overboard. Leche! Kung hindi sana ako nagpuyat, malamang "dedma" lang sana ako at sobrang lakas ng resistance ko sa mga intrigang to' gaya ng normal na buhay buhay sa bansang pilipinas. Mukang kelangan ko na mgpainterview kay kaibigang Boy sa "the buzz" sa linggo ah.

(*transition sound effects)
SSSUSUNOOOD!!!
Isang pananahimik ang mababasag!
Isang rebelasyon ang mabubunyag!
ABANGAN!!!

no man is an island

2008-11-17T21:43:00.000+08:00

sa tagalog, "walang taong mukhang isla"... Kung sabagay wala pa akong nakikitang taong mukhang isla, kaya sa tingin ko, mukhang tama yan...
pero kung isasantabi mo ang kalokohan at magiisip ng medyo maayos, isalin mo uli sa wikang tagalog, "walang taong nagiisa". at sa tingin ko, at sana, totoo yan! (emo emo mode)
pero, sa pagkakataong ito, sa tingin ko hindi ganon palagi ang kaso. ang tanong, ano ang gagawin mo sa pagkakataong nagiisa ka?

lactose intolerant

2008-11-17T18:17:00.000+08:00

May mga tao na bagama't malusog ay kulang sa enzyme na kailangan sa pagtunaw ng lactose, ang asukal sa gatas ng baka. Dahil dito, dumadaan sa proseso ng fermentation ang lactose sa colon, at lumilikha ng maraming hydrogen at carbon dioxide. Ang kondisyon na ito na kadalasan ding dahilan ng pamumulikat ng tiyan ay tinatawag na "lactose intolerance". Bukod d'yan, ang Sorbitol na ginagamit bilang pampatamis sa mga diebetic diets, jams, at sugarless chewing gum, ay hindi rin natututnaw sa maliit na bituka. Sa halip, ito ay nagiging dagdag "utot" tulad ng lactose.
-page 133, ang paboritong libro ni hudas, bob ong

Ok lng sana kung hindi ako lumantak ng sandamukal na spaghetti na binudburan ng sandamukal na keso. In-short, matigas ang ulo mo!
Pano ka ngaun sasakay sa jeep na hindi naririnig ng katabi mo ang pagkulo ng tyan mo na parang bulkang mayon na malapit nag sumabog?
eeeeeeewwwwwwwwww!!!!!!!!!!!!!!
As usual, bahala na si batman...

magneto

2008-11-16T16:20:00.000+08:00

ever feel like you're magneto sometimes?
(dun sa hindi nakakakilala kay magneto, wala akong pakelam sa iñu)

You'll walk in a particular side of the road, then suddenly, there were five of you standing on the same spot. You'll let it fly, five seconds later i will happen again? You'll just say to yourself, "P**a, ang luwag luwag naman ng daan bakit dito pa kame ngsisiksikan?". Ganon ba talaga kapag artista ka?

test

2008-11-16T00:21:00.000+08:00

1 2 3